Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 733063..733756 | Replicon | chromosome |
Accession | NZ_CP126343 | ||
Organism | Escherichia coli strain DAX4 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | S1EZG2 |
Locus tag | QN220_RS03590 | Protein ID | WP_000415584.1 |
Coordinates | 733063..733359 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | S1EBV2 |
Locus tag | QN220_RS03595 | Protein ID | WP_000650107.1 |
Coordinates | 733361..733756 (+) | Length | 132 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QN220_RS03555 (728151) | 728151..728465 | - | 315 | WP_000958598.1 | putative quinol monooxygenase | - |
QN220_RS03560 (728496) | 728496..729077 | - | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
QN220_RS03565 (729396) | 729396..729728 | + | 333 | WP_000917684.1 | DUF2645 family protein | - |
QN220_RS03570 (729774) | 729774..731123 | - | 1350 | WP_000673402.1 | quorum sensing histidine kinase QseC | - |
QN220_RS03575 (731120) | 731120..731779 | - | 660 | WP_001221493.1 | quorum sensing response regulator transcription factor QseB | - |
QN220_RS03580 (731931) | 731931..732323 | + | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
QN220_RS03585 (732376) | 732376..732858 | + | 483 | WP_284562160.1 | GyrI-like domain-containing protein | - |
QN220_RS03590 (733063) | 733063..733359 | + | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
QN220_RS03595 (733361) | 733361..733756 | + | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
QN220_RS03600 (733889) | 733889..735496 | + | 1608 | WP_153443585.1 | ABC transporter substrate-binding protein | - |
QN220_RS03605 (735634) | 735634..737892 | + | 2259 | WP_001281881.1 | DNA topoisomerase IV subunit A | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T282849 WP_000415584.1 NZ_CP126343:733063-733359 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT282849 WP_000650107.1 NZ_CP126343:733361-733756 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|