Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 1543856..1544502 | Replicon | chromosome |
Accession | NZ_CP126339 | ||
Organism | Atlantibacter hermannii strain TL13 |
Toxin (Protein)
Gene name | higB | Uniprot ID | H5UXB4 |
Locus tag | QN094_RS07120 | Protein ID | WP_002463190.1 |
Coordinates | 1543856..1544209 (+) | Length | 118 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QN094_RS07125 | Protein ID | WP_220397671.1 |
Coordinates | 1544206..1544502 (+) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QN094_RS07110 (QN094_07110) | 1539253..1542375 | - | 3123 | WP_165432039.1 | MdtB/MuxB family multidrug efflux RND transporter permease subunit | - |
QN094_RS07115 (QN094_07115) | 1542375..1543628 | - | 1254 | WP_284556272.1 | MdtA/MuxA family multidrug efflux RND transporter periplasmic adaptor subunit | - |
QN094_RS07120 (QN094_07120) | 1543856..1544209 | + | 354 | WP_002463190.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QN094_RS07125 (QN094_07125) | 1544206..1544502 | + | 297 | WP_220397671.1 | helix-turn-helix transcriptional regulator | Antitoxin |
QN094_RS07130 (QN094_07130) | 1544525..1545877 | - | 1353 | WP_284556440.1 | molecular chaperone | - |
QN094_RS07135 (QN094_07135) | 1546009..1546863 | + | 855 | WP_002463186.1 | DNA-3-methyladenine glycosylase 2 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13569.72 Da Isoelectric Point: 10.0566
>T282822 WP_002463190.1 NZ_CP126339:1543856-1544209 [Atlantibacter hermannii]
MTWTVVLTPEFEQWFDKQEAGLQDRINMMITLLEISGPNLGRPHVDTLVGSRYPNMKELRIQYAGEPWRVGFAFNHRQQA
VLLYGGQKTGKKRFYTLLIAQVDAIFARDLARKKETL
MTWTVVLTPEFEQWFDKQEAGLQDRINMMITLLEISGPNLGRPHVDTLVGSRYPNMKELRIQYAGEPWRVGFAFNHRQQA
VLLYGGQKTGKKRFYTLLIAQVDAIFARDLARKKETL
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|