Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4518228..4518988 | Replicon | chromosome |
| Accession | NZ_CP126329 | ||
| Organism | Citrobacter braakii strain THB2 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A7L6U900 |
| Locus tag | QN090_RS21845 | Protein ID | WP_019077936.1 |
| Coordinates | 4518228..4518539 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QN090_RS21850 | Protein ID | WP_046275270.1 |
| Coordinates | 4518536..4518988 (+) | Length | 151 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QN090_RS21815 (4513895) | 4513895..4514797 | + | 903 | WP_003028691.1 | formate dehydrogenase O subunit beta | - |
| QN090_RS21820 (4514794) | 4514794..4515429 | + | 636 | WP_003028686.1 | formate dehydrogenase cytochrome b556 subunit | - |
| QN090_RS21825 (4515426) | 4515426..4516355 | + | 930 | WP_003028685.1 | formate dehydrogenase accessory protein FdhE | - |
| QN090_RS21830 (4516392) | 4516392..4516766 | - | 375 | WP_016155182.1 | type II toxin-antitoxin system VapC family toxin | - |
| QN090_RS21835 (4516766) | 4516766..4517008 | - | 243 | WP_016155181.1 | CopG family transcriptional regulator | - |
| QN090_RS21840 (4517214) | 4517214..4518143 | + | 930 | WP_075848764.1 | alpha/beta hydrolase | - |
| QN090_RS21845 (4518228) | 4518228..4518539 | + | 312 | WP_019077936.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| QN090_RS21850 (4518536) | 4518536..4518988 | + | 453 | WP_046275270.1 | helix-turn-helix domain-containing protein | Antitoxin |
| QN090_RS21855 (4519006) | 4519006..4519947 | - | 942 | WP_003825286.1 | fatty acid biosynthesis protein FabY | - |
| QN090_RS21860 (4519992) | 4519992..4520429 | - | 438 | WP_016157874.1 | D-aminoacyl-tRNA deacylase | - |
| QN090_RS21865 (4520426) | 4520426..4521298 | - | 873 | WP_019077938.1 | virulence factor BrkB family protein | - |
| QN090_RS21870 (4521292) | 4521292..4521891 | - | 600 | WP_016155174.1 | glucose-1-phosphatase | - |
| QN090_RS21875 (4522159) | 4522159..4523187 | - | 1029 | WP_047357782.1 | LacI family DNA-binding transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12502.67 Da Isoelectric Point: 9.9988
>T282799 WP_019077936.1 NZ_CP126329:4518228-4518539 [Citrobacter braakii]
MHVISRKPFNEAILRFPNHMAALVDLLNILEKKMFHTPEEMKQYIPSLDNFKYRNKWWVINVSGNCLRLIAYIDFKLQKV
FVKHIVHHAEYDRLTTYYRGHKE
MHVISRKPFNEAILRFPNHMAALVDLLNILEKKMFHTPEEMKQYIPSLDNFKYRNKWWVINVSGNCLRLIAYIDFKLQKV
FVKHIVHHAEYDRLTTYYRGHKE
Download Length: 312 bp
Antitoxin
Download Length: 151 a.a. Molecular weight: 16984.36 Da Isoelectric Point: 5.9258
>AT282799 WP_046275270.1 NZ_CP126329:4518536-4518988 [Citrobacter braakii]
MRTHESHQIDTASVKLMIDTFTDAVKKIPLLGKEQNEAEYRKALALVEYLVDRDDLENPLFELLSARIRDYEKHAPEFSA
LNQQLEHTPHGVALLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVSHIKMLAERFNLPADAFIE
MRTHESHQIDTASVKLMIDTFTDAVKKIPLLGKEQNEAEYRKALALVEYLVDRDDLENPLFELLSARIRDYEKHAPEFSA
LNQQLEHTPHGVALLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVSHIKMLAERFNLPADAFIE
Download Length: 453 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|