Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/Tad-HTH_37
Location 1916541..1917069 Replicon chromosome
Accession NZ_CP126325
Organism Salmonella enterica subsp. enterica strain HL21

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag QN088_RS09095 Protein ID WP_108429764.1
Coordinates 1916839..1917069 (-) Length 77 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag QN088_RS09090 Protein ID WP_000147078.1
Coordinates 1916541..1916849 (-) Length 103 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QN088_RS09045 (1912073) 1912073..1912900 - 828 WP_000080416.1 DUF2303 family protein -
QN088_RS09050 (1912958) 1912958..1913329 - 372 WP_000997190.1 hypothetical protein -
QN088_RS09055 (1913553) 1913553..1913672 - 120 Protein_1769 hypothetical protein -
QN088_RS09060 (1913869) 1913869..1914093 + 225 WP_157969862.1 hypothetical protein -
QN088_RS09065 (1914056) 1914056..1914394 - 339 WP_001067432.1 ClpX C4-type zinc finger protein -
QN088_RS09070 (1914600) 1914600..1915295 - 696 WP_001020636.1 helix-turn-helix transcriptional regulator -
QN088_RS09075 (1915393) 1915393..1915617 + 225 WP_001191666.1 helix-turn-helix transcriptional regulator -
QN088_RS09080 (1915646) 1915646..1916200 + 555 WP_023139406.1 YmfL family putative regulatory protein -
QN088_RS09085 (1916346) 1916346..1916522 + 177 WP_000281065.1 DUF4222 domain-containing protein -
QN088_RS09090 (1916541) 1916541..1916849 - 309 WP_000147078.1 helix-turn-helix transcriptional regulator Antitoxin
QN088_RS09095 (1916839) 1916839..1917069 - 231 WP_108429764.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QN088_RS09100 (1917034) 1917034..1918047 + 1014 WP_241966668.1 Rha family phage regulatory protein -
QN088_RS09105 (1918044) 1918044..1918268 + 225 WP_000620702.1 hypothetical protein -
QN088_RS09110 (1918265) 1918265..1919239 + 975 WP_000096532.1 conserved phage C-terminal domain-containing protein -
QN088_RS09115 (1919236) 1919236..1919709 + 474 WP_118998778.1 hypothetical protein -
QN088_RS09120 (1919706) 1919706..1920587 + 882 WP_118998777.1 Dam family site-specific DNA-(adenine-N6)-methyltransferase -
QN088_RS09125 (1920596) 1920596..1920985 + 390 WP_000779148.1 RusA family crossover junction endodeoxyribonuclease -
QN088_RS09130 (1921002) 1921002..1921862 + 861 WP_157969861.1 KilA-N domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1877294..1955453 78159


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(5-70)

Antitoxin

Cro/C1-type helix-turn-helix domain

(44-94)


Sequences

Toxin        


Download         Length: 77 a.a.        Molecular weight: 8640.11 Da        Isoelectric Point: 10.5308

>T282771 WP_108429764.1 NZ_CP126325:c1917069-1916839 [Salmonella enterica subsp. enterica]
MKVYGSNLGEPHTSAFGDGLFELRIKGSDGIARVFYCTLAGKRIVMLHSFIKKTQKTPVAERKKAETRMKEVKHDW

Download         Length: 231 bp

Antitoxin


Download         Length: 103 a.a.        Molecular weight: 11110.77 Da        Isoelectric Point: 7.0152

>AT282771 WP_000147078.1 NZ_CP126325:c1916849-1916541 [Salmonella enterica subsp. enterica]
MTGKRNAPTITHDEMAAKWMEDPAFKAEYDAIADEFALLDEMLAARKEAGLTQAEVAERMGTKATAITRMESNLAAGVSG
PSFTTLKKFAQATGKKLQIRFV

Download         Length: 309 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References