Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 1902251..1902911 | Replicon | chromosome |
| Accession | NZ_CP126325 | ||
| Organism | Salmonella enterica subsp. enterica strain HL21 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A3Z1E706 |
| Locus tag | QN088_RS08975 | Protein ID | WP_000269841.1 |
| Coordinates | 1902251..1902604 (+) | Length | 118 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QN088_RS08980 | Protein ID | WP_000533827.1 |
| Coordinates | 1902609..1902911 (+) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QN088_RS08945 (1898321) | 1898321..1899076 | + | 756 | WP_023245134.1 | multiubiquitin domain-containing protein | - |
| QN088_RS08950 (1899051) | 1899051..1899899 | + | 849 | WP_284546275.1 | ThiF family adenylyltransferase | - |
| QN088_RS08955 (1899944) | 1899944..1900234 | + | 291 | WP_242617175.1 | hypothetical protein | - |
| QN088_RS08960 (1900228) | 1900228..1900692 | + | 465 | WP_000912782.1 | DUF6527 family protein | - |
| QN088_RS08965 (1901069) | 1901069..1901536 | + | 468 | WP_000201258.1 | hypothetical protein | - |
| QN088_RS08970 (1901536) | 1901536..1901754 | + | 219 | WP_161976074.1 | cell morphology transcriptional regulator XreR2 | - |
| QN088_RS08975 (1902251) | 1902251..1902604 | + | 354 | WP_000269841.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QN088_RS08980 (1902609) | 1902609..1902911 | + | 303 | WP_000533827.1 | XRE family transcriptional regulator | Antitoxin |
| QN088_RS08985 (1903417) | 1903417..1904301 | + | 885 | WP_284546276.1 | integrase domain-containing protein | - |
| QN088_RS08990 (1905170) | 1905170..1906432 | - | 1263 | WP_000058784.1 | integrase arm-type DNA-binding domain-containing protein | - |
| QN088_RS09000 (1906770) | 1906770..1907567 | - | 798 | WP_000598920.1 | DgsA anti-repressor MtfA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1877294..1955453 | 78159 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13477.35 Da Isoelectric Point: 9.5699
>T282770 WP_000269841.1 NZ_CP126325:1902251-1902604 [Salmonella enterica subsp. enterica]
VWTIKTTDTFDRWFASLNDTDRVSVLAALLVLREKGPGLSRPYADTVRGSRYSNMKELRIQSRGEPIRAFFAFDPTRTGI
VLCAGNKVGNEKRFYDEMLPVADREFTNWLNTLKEKE
VWTIKTTDTFDRWFASLNDTDRVSVLAALLVLREKGPGLSRPYADTVRGSRYSNMKELRIQSRGEPIRAFFAFDPTRTGI
VLCAGNKVGNEKRFYDEMLPVADREFTNWLNTLKEKE
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|