Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 3052975..3053636 | Replicon | chromosome |
| Accession | NZ_CP126169 | ||
| Organism | Rahnella bonaserana strain L46 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | QNM34_RS13810 | Protein ID | WP_284002192.1 |
| Coordinates | 3053277..3053636 (-) | Length | 120 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QNM34_RS13805 | Protein ID | WP_217172903.1 |
| Coordinates | 3052975..3053277 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QNM34_RS13795 (QNM34_13795) | 3050687..3051975 | - | 1289 | Protein_2705 | TrbI/VirB10 family protein | - |
| QNM34_RS13800 (QNM34_13800) | 3051978..3052384 | - | 407 | Protein_2706 | TrbG/VirB9 family P-type conjugative transfer protein | - |
| QNM34_RS13805 (QNM34_13805) | 3052975..3053277 | - | 303 | WP_217172903.1 | XRE family transcriptional regulator | Antitoxin |
| QNM34_RS13810 (QNM34_13810) | 3053277..3053636 | - | 360 | WP_284002192.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QNM34_RS13815 (QNM34_13815) | 3053847..3053999 | - | 153 | WP_217172905.1 | Hok/Gef family protein | - |
| QNM34_RS13820 (QNM34_13820) | 3054346..3055659 | + | 1314 | WP_284002195.1 | FAD-binding oxidoreductase | - |
| QNM34_RS13825 (QNM34_13825) | 3055702..3056358 | - | 657 | WP_120161833.1 | methionine ABC transporter permease | - |
| QNM34_RS13830 (QNM34_13830) | 3056339..3057493 | - | 1155 | WP_217172907.1 | methionine ABC transporter ATP-binding protein | - |
| QNM34_RS13835 (QNM34_13835) | 3057504..3058346 | - | 843 | WP_284002197.1 | MetQ/NlpA family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 120 a.a. Molecular weight: 13638.66 Da Isoelectric Point: 7.9097
>T282726 WP_284002192.1 NZ_CP126169:c3053636-3053277 [Rahnella bonaserana]
VWIINTTERFDDWFDSLDHVDQASVLALAIVLKDKGPALSRPYADTVNNSCHRNMKELRILSKGEPIRAFFAFDPLRRGI
LLCAGHKAGNEKRFYNVMIPVADNEFSRHLNTIKEKELP
VWIINTTERFDDWFDSLDHVDQASVLALAIVLKDKGPALSRPYADTVNNSCHRNMKELRILSKGEPIRAFFAFDPLRRGI
LLCAGHKAGNEKRFYNVMIPVADNEFSRHLNTIKEKELP
Download Length: 360 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|