Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 2458151..2458776 | Replicon | chromosome |
Accession | NZ_CP126166 | ||
Organism | Salmonella enterica subsp. enterica strain CRSE-01 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | M7SD17 |
Locus tag | NED09_RS11810 | Protein ID | WP_000911336.1 |
Coordinates | 2458378..2458776 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | M7S3S8 |
Locus tag | NED09_RS11805 | Protein ID | WP_000557549.1 |
Coordinates | 2458151..2458378 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NED09_RS11775 (2453159) | 2453159..2454676 | + | 1518 | WP_000003339.1 | lysine--tRNA ligase | - |
NED09_RS11780 (2454752) | 2454752..2455297 | - | 546 | WP_000133994.1 | isopentenyl-diphosphate Delta-isomerase | - |
NED09_RS11785 (2455562) | 2455562..2456320 | + | 759 | WP_000244328.1 | amidase activator ActS | - |
NED09_RS11795 (2456605) | 2456605..2457411 | - | 807 | WP_001574939.1 | DUF1460 domain-containing protein | - |
NED09_RS11800 (2457691) | 2457691..2457942 | - | 252 | WP_001576352.1 | hypothetical protein | - |
NED09_RS11805 (2458151) | 2458151..2458378 | + | 228 | WP_000557549.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
NED09_RS11810 (2458378) | 2458378..2458776 | + | 399 | WP_000911336.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
NED09_RS11815 (2459584) | 2459584..2460120 | + | 537 | WP_001038502.1 | STM3031 family outer membrane protein | - |
NED09_RS11820 (2460167) | 2460167..2460799 | + | 633 | WP_000835265.1 | YfdX family protein | - |
NED09_RS11825 (2461518) | 2461518..2462099 | + | 582 | WP_001244651.1 | fimbrial protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 2456605..2467960 | 11355 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14938.30 Da Isoelectric Point: 7.2155
>T282713 WP_000911336.1 NZ_CP126166:2458378-2458776 [Salmonella enterica subsp. enterica]
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHAGSRGLVVVTNNLREFERIPGIRIEDWC
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHAGSRGLVVVTNNLREFERIPGIRIEDWC
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 6IFC | |
PDB | 6IFM |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6IFM | |
AlphaFold DB | A0A3V2Y5V5 |