Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 1430854..1431456 | Replicon | chromosome |
| Accession | NZ_CP126166 | ||
| Organism | Salmonella enterica subsp. enterica strain CRSE-01 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | M7S4R6 |
| Locus tag | NED09_RS06845 | Protein ID | WP_001159635.1 |
| Coordinates | 1431145..1431456 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NED09_RS06840 | Protein ID | WP_000362050.1 |
| Coordinates | 1430854..1431144 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NED09_RS06825 (1428347) | 1428347..1429249 | + | 903 | WP_000331364.1 | formate dehydrogenase subunit beta | - |
| NED09_RS06830 (1429246) | 1429246..1429881 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| NED09_RS06835 (1429878) | 1429878..1430807 | + | 930 | WP_000027736.1 | formate dehydrogenase accessory protein FdhE | - |
| NED09_RS06840 (1430854) | 1430854..1431144 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | Antitoxin |
| NED09_RS06845 (1431145) | 1431145..1431456 | - | 312 | WP_001159635.1 | cytotoxic translational repressor of toxin-antitoxin stability system | Toxin |
| NED09_RS06850 (1431674) | 1431674..1432603 | + | 930 | WP_001127705.1 | alpha/beta hydrolase | - |
| NED09_RS06855 (1432689) | 1432689..1433000 | + | 312 | WP_000558168.1 | type II toxin-antitoxin system HigB family toxin | - |
| NED09_RS06860 (1432997) | 1432997..1433443 | + | 447 | WP_001259009.1 | type II toxin-antitoxin system HigA family antitoxin | - |
| NED09_RS06865 (1433458) | 1433458..1434399 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| NED09_RS06870 (1434444) | 1434444..1434881 | - | 438 | WP_000560968.1 | D-aminoacyl-tRNA deacylase | - |
| NED09_RS06875 (1434878) | 1434878..1435750 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| NED09_RS06880 (1435744) | 1435744..1436343 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12340.30 Da Isoelectric Point: 9.4460
>T282707 WP_001159635.1 NZ_CP126166:c1431456-1431145 [Salmonella enterica subsp. enterica]
MQFIETELFTEDVKKLLDEDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGARGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
MQFIETELFTEDVKKLLDEDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGARGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|