Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 2449588..2450110 | Replicon | chromosome |
Accession | NZ_CP126138 | ||
Organism | Salmonella enterica subsp. enterica serovar Kottbus strain DSK01 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | B5F5Y5 |
Locus tag | QNM33_RS12075 | Protein ID | WP_000221343.1 |
Coordinates | 2449826..2450110 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | V1H457 |
Locus tag | QNM33_RS12070 | Protein ID | WP_000885424.1 |
Coordinates | 2449588..2449836 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QNM33_RS12045 (2445569) | 2445569..2446270 | + | 702 | Protein_2354 | hypothetical protein | - |
QNM33_RS12050 (2447078) | 2447078..2447792 | + | 715 | Protein_2355 | helix-turn-helix domain-containing protein | - |
QNM33_RS12055 (2447848) | 2447848..2448756 | - | 909 | WP_010989018.1 | hypothetical protein | - |
QNM33_RS12060 (2448899) | 2448899..2449231 | - | 333 | WP_000253154.1 | DUF1493 family protein | - |
QNM33_RS12065 (2449221) | 2449221..2449436 | - | 216 | WP_000206207.1 | hypothetical protein | - |
QNM33_RS12070 (2449588) | 2449588..2449836 | + | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
QNM33_RS12075 (2449826) | 2449826..2450110 | + | 285 | WP_000221343.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QNM33_RS12080 (2450281) | 2450281..2450670 | + | 390 | WP_000194089.1 | RidA family protein | - |
QNM33_RS12085 (2450722) | 2450722..2451801 | - | 1080 | WP_000954688.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
QNM33_RS12090 (2451994) | 2451994..2452482 | - | 489 | WP_001293638.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
QNM33_RS12095 (2452527) | 2452527..2454035 | + | 1509 | WP_000199411.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 2444583..2456892 | 12309 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11075.85 Da Isoelectric Point: 10.6500
>T282662 WP_000221343.1 NZ_CP126138:2449826-2450110 [Salmonella enterica subsp. enterica serovar Kottbus]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JSW4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0WPN5 |