Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | yonT-SR6/- |
| Location | 2252765..2252982 | Replicon | chromosome |
| Accession | NZ_CP126100 | ||
| Organism | Bacillus halotolerans strain LN2 | ||
Toxin (Protein)
| Gene name | yonT | Uniprot ID | - |
| Locus tag | QNH41_RS11440 | Protein ID | WP_017696861.1 |
| Coordinates | 2252806..2252982 (-) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SR6 | ||
| Locus tag | - | ||
| Coordinates | 2252765..2252865 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QNH41_RS11420 | 2248784..2250652 | - | 1869 | WP_283912367.1 | hypothetical protein | - |
| QNH41_RS11425 | 2250989..2252221 | - | 1233 | WP_283912368.1 | hypothetical protein | - |
| QNH41_RS11430 | 2252303..2252491 | - | 189 | WP_004399547.1 | hypothetical protein | - |
| QNH41_RS11435 | 2252536..2252787 | - | 252 | WP_080010576.1 | hypothetical protein | - |
| - | 2252765..2252865 | + | 101 | - | - | Antitoxin |
| QNH41_RS11440 | 2252806..2252982 | - | 177 | WP_017696861.1 | hypothetical protein | Toxin |
| - | 2252923..2253020 | + | 98 | NuclAT_0 | - | - |
| - | 2252923..2253020 | + | 98 | NuclAT_0 | - | - |
| - | 2252923..2253020 | + | 98 | NuclAT_0 | - | - |
| - | 2252923..2253020 | + | 98 | NuclAT_0 | - | - |
| QNH41_RS11445 | 2253947..2254141 | + | 195 | WP_283912369.1 | hypothetical protein | - |
| QNH41_RS11450 | 2254181..2256709 | + | 2529 | WP_283912370.1 | hypothetical protein | - |
| QNH41_RS11455 | 2256962..2257240 | + | 279 | WP_213384713.1 | HU family DNA-binding protein | - |
| QNH41_RS11460 | 2257800..2257910 | + | 111 | Protein_2205 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2182701..2348943 | 166242 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6878.45 Da Isoelectric Point: 12.8833
>T282623 WP_017696861.1 NZ_CP126100:c2252982-2252806 [Bacillus halotolerans]
VLEKVGIIVAFLISLTVLTINSLTIVEKIRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
VLEKVGIIVAFLISLTVLTINSLTIVEKIRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
Download Length: 177 bp
Antitoxin
Download Length: 101 bp
>AT282623 NZ_CP126100:2252765-2252865 [Bacillus halotolerans]
TAGGAACTAAAGGAGAAGTTCATTCCCCTTTAGCTTAGCTCTCATCGGCGTATACGTTGGCGTTGTCTCTTTGGTCGGAG
CCGCTTGCGTATACGCTTTTT
TAGGAACTAAAGGAGAAGTTCATTCCCCTTTAGCTTAGCTCTCATCGGCGTATACGTTGGCGTTGTCTCTTTGGTCGGAG
CCGCTTGCGTATACGCTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|