Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | yonT-as-bsrE/- |
Location | 2252536..2253020 | Replicon | chromosome |
Accession | NZ_CP126100 | ||
Organism | Bacillus halotolerans strain LN2 |
Toxin (Protein)
Gene name | yonT | Uniprot ID | - |
Locus tag | QNH41_RS11435 | Protein ID | WP_080010576.1 |
Coordinates | 2252536..2252787 (-) | Length | 84 a.a. |
Antitoxin (RNA)
Gene name | as-bsrE | ||
Locus tag | - | ||
Coordinates | 2252923..2253020 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QNH41_RS11420 (2248784) | 2248784..2250652 | - | 1869 | WP_283912367.1 | hypothetical protein | - |
QNH41_RS11425 (2250989) | 2250989..2252221 | - | 1233 | WP_283912368.1 | hypothetical protein | - |
QNH41_RS11430 (2252303) | 2252303..2252491 | - | 189 | WP_004399547.1 | hypothetical protein | - |
QNH41_RS11435 (2252536) | 2252536..2252787 | - | 252 | WP_080010576.1 | hypothetical protein | Toxin |
QNH41_RS11440 (2252806) | 2252806..2252982 | - | 177 | WP_017696861.1 | hypothetical protein | - |
- (2252923) | 2252923..2253020 | + | 98 | NuclAT_0 | - | Antitoxin |
- (2252923) | 2252923..2253020 | + | 98 | NuclAT_0 | - | Antitoxin |
- (2252923) | 2252923..2253020 | + | 98 | NuclAT_0 | - | Antitoxin |
- (2252923) | 2252923..2253020 | + | 98 | NuclAT_0 | - | Antitoxin |
QNH41_RS11445 (2253947) | 2253947..2254141 | + | 195 | WP_283912369.1 | hypothetical protein | - |
QNH41_RS11450 (2254181) | 2254181..2256709 | + | 2529 | WP_283912370.1 | hypothetical protein | - |
QNH41_RS11455 (2256962) | 2256962..2257240 | + | 279 | WP_213384713.1 | HU family DNA-binding protein | - |
QNH41_RS11460 (2257800) | 2257800..2257910 | + | 111 | Protein_2205 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2182701..2348943 | 166242 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 84 a.a. Molecular weight: 10071.13 Da Isoelectric Point: 10.0301
>T282622 WP_080010576.1 NZ_CP126100:c2252787-2252536 [Bacillus halotolerans]
MNFSFSSYPYYNMIKHIANMKRFSLWFTHITFIGLFLMFQLIKDYFSSEAQTLINIIFIVTCIIAILLWIIYFVFLKLRN
KSH
MNFSFSSYPYYNMIKHIANMKRFSLWFTHITFIGLFLMFQLIKDYFSSEAQTLINIIFIVTCIIAILLWIIYFVFLKLRN
KSH
Download Length: 252 bp
Antitoxin
Download Length: 98 bp
>AT282622 NZ_CP126100:2252923-2253020 [Bacillus halotolerans]
GATTGTAAGAACCGTTAAAGATATGAGGAAAGCAACTATGATACCCACTTTCTCAAGCACTATGTACACCTCCTTTCCTT
TGACTCTATTATAACATA
GATTGTAAGAACCGTTAAAGATATGAGGAAAGCAACTATGATACCCACTTTCTCAAGCACTATGTACACCTCCTTTCCTT
TGACTCTATTATAACATA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|