Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | yonT-SR6/- |
| Location | 2178290..2178504 | Replicon | chromosome |
| Accession | NZ_CP126097 | ||
| Organism | Bacillus subtilis strain KF24 | ||
Toxin (Protein)
| Gene name | yonT | Uniprot ID | - |
| Locus tag | QNK06_RS11305 | Protein ID | WP_192857822.1 |
| Coordinates | 2178290..2178466 (-) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SR6 | ||
| Locus tag | - | ||
| Coordinates | 2178407..2178504 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QNK06_RS11255 (2173953) | 2173953..2174105 | - | 153 | WP_154816883.1 | hypothetical protein | - |
| QNK06_RS11260 (2174106) | 2174106..2174360 | - | 255 | WP_052475792.1 | hypothetical protein | - |
| QNK06_RS11265 (2174375) | 2174375..2174518 | - | 144 | WP_234939184.1 | hypothetical protein | - |
| QNK06_RS11270 (2174812) | 2174812..2175048 | - | 237 | WP_283933491.1 | hypothetical protein | - |
| QNK06_RS11275 (2175222) | 2175222..2175476 | - | 255 | WP_262091559.1 | hypothetical protein | - |
| QNK06_RS11280 (2175519) | 2175519..2175740 | - | 222 | WP_124058424.1 | hypothetical protein | - |
| QNK06_RS11285 (2175737) | 2175737..2176189 | - | 453 | WP_192857820.1 | hypothetical protein | - |
| QNK06_RS11290 (2176513) | 2176513..2177730 | - | 1218 | WP_192857821.1 | hypothetical protein | - |
| QNK06_RS11295 (2177818) | 2177818..2177976 | - | 159 | WP_283933492.1 | hypothetical protein | - |
| QNK06_RS11300 (2178021) | 2178021..2178271 | - | 251 | Protein_2176 | hypothetical protein | - |
| QNK06_RS11305 (2178290) | 2178290..2178466 | - | 177 | WP_192857822.1 | hypothetical protein | Toxin |
| - (2178407) | 2178407..2178504 | + | 98 | NuclAT_0 | - | Antitoxin |
| - (2178407) | 2178407..2178504 | + | 98 | NuclAT_0 | - | Antitoxin |
| - (2178407) | 2178407..2178504 | + | 98 | NuclAT_0 | - | Antitoxin |
| - (2178407) | 2178407..2178504 | + | 98 | NuclAT_0 | - | Antitoxin |
| QNK06_RS11310 (2179000) | 2179000..2179611 | - | 612 | WP_074794693.1 | hypothetical protein | - |
| QNK06_RS11315 (2179812) | 2179812..2180140 | - | 329 | Protein_2179 | helix-turn-helix transcriptional regulator | - |
| QNK06_RS11320 (2181035) | 2181035..2181334 | - | 300 | WP_283933493.1 | hypothetical protein | - |
| QNK06_RS11325 (2181339) | 2181339..2181536 | - | 198 | WP_283933494.1 | hypothetical protein | - |
| QNK06_RS11330 (2181910) | 2181910..2182089 | + | 180 | WP_041338634.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2110873..2246195 | 135322 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6894.45 Da Isoelectric Point: 12.8833
>T282611 WP_192857822.1 NZ_CP126097:c2178466-2178290 [Bacillus subtilis]
VLEKVGIIVSFLISLTVLTINSLTIVEKIRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
VLEKVGIIVSFLISLTVLTINSLTIVEKIRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
Download Length: 177 bp
Antitoxin
Download Length: 98 bp
>AT282611 NZ_CP126097:2178407-2178504 [Bacillus subtilis]
GATTGTAAGAACCGTTAAAGATATGAGGAAAGAAACTATGATACCCACTTTCTCAAGCACTATGTACACCTCCTTTCCAA
TGACTCTATTATAACATA
GATTGTAAGAACCGTTAAAGATATGAGGAAAGAAACTATGATACCCACTTTCTCAAGCACTATGTACACCTCCTTTCCAA
TGACTCTATTATAACATA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|