Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | yonT-SR6/- |
Location | 2178252..2178466 | Replicon | chromosome |
Accession | NZ_CP126097 | ||
Organism | Bacillus subtilis strain KF24 |
Toxin (Protein)
Gene name | yonT | Uniprot ID | - |
Locus tag | QNK06_RS11305 | Protein ID | WP_192857822.1 |
Coordinates | 2178290..2178466 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SR6 | ||
Locus tag | - | ||
Coordinates | 2178252..2178349 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QNK06_RS11255 | 2173953..2174105 | - | 153 | WP_154816883.1 | hypothetical protein | - |
QNK06_RS11260 | 2174106..2174360 | - | 255 | WP_052475792.1 | hypothetical protein | - |
QNK06_RS11265 | 2174375..2174518 | - | 144 | WP_234939184.1 | hypothetical protein | - |
QNK06_RS11270 | 2174812..2175048 | - | 237 | WP_283933491.1 | hypothetical protein | - |
QNK06_RS11275 | 2175222..2175476 | - | 255 | WP_262091559.1 | hypothetical protein | - |
QNK06_RS11280 | 2175519..2175740 | - | 222 | WP_124058424.1 | hypothetical protein | - |
QNK06_RS11285 | 2175737..2176189 | - | 453 | WP_192857820.1 | hypothetical protein | - |
QNK06_RS11290 | 2176513..2177730 | - | 1218 | WP_192857821.1 | hypothetical protein | - |
QNK06_RS11295 | 2177818..2177976 | - | 159 | WP_283933492.1 | hypothetical protein | - |
QNK06_RS11300 | 2178021..2178271 | - | 251 | Protein_2176 | hypothetical protein | - |
- | 2178252..2178349 | + | 98 | - | - | Antitoxin |
QNK06_RS11305 | 2178290..2178466 | - | 177 | WP_192857822.1 | hypothetical protein | Toxin |
- | 2178407..2178504 | + | 98 | NuclAT_0 | - | - |
- | 2178407..2178504 | + | 98 | NuclAT_0 | - | - |
- | 2178407..2178504 | + | 98 | NuclAT_0 | - | - |
- | 2178407..2178504 | + | 98 | NuclAT_0 | - | - |
QNK06_RS11310 | 2179000..2179611 | - | 612 | WP_074794693.1 | hypothetical protein | - |
QNK06_RS11315 | 2179812..2180140 | - | 329 | Protein_2179 | helix-turn-helix transcriptional regulator | - |
QNK06_RS11320 | 2181035..2181334 | - | 300 | WP_283933493.1 | hypothetical protein | - |
QNK06_RS11325 | 2181339..2181536 | - | 198 | WP_283933494.1 | hypothetical protein | - |
QNK06_RS11330 | 2181910..2182089 | + | 180 | WP_041338634.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2110873..2246195 | 135322 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6894.45 Da Isoelectric Point: 12.8833
>T282609 WP_192857822.1 NZ_CP126097:c2178466-2178290 [Bacillus subtilis]
VLEKVGIIVSFLISLTVLTINSLTIVEKIRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
VLEKVGIIVSFLISLTVLTINSLTIVEKIRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
Download Length: 177 bp
Antitoxin
Download Length: 98 bp
>AT282609 NZ_CP126097:2178252-2178349 [Bacillus subtilis]
GAACTAAAGGAGAAGTTCATTCCCCTTTAGCTTAGCTCTCATCGGCGTATACGTTGGCGTTGTCTCTTTGGTCGGAGCCG
CTTGCGTATACGCTTTTT
GAACTAAAGGAGAAGTTCATTCCCCTTTAGCTTAGCTCTCATCGGCGTATACGTTGGCGTTGTCTCTTTGGTCGGAGCCG
CTTGCGTATACGCTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|