Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprG3-SprA2AS/- |
Location | 2178267..2178465 | Replicon | chromosome |
Accession | NC_018608 | ||
Organism | Staphylococcus aureus 08BA02176 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | C248_RS10850 | Protein ID | WP_001802298.1 |
Coordinates | 2178361..2178465 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2178267..2178305 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C248_RS10830 | 2174387..2175052 | - | 666 | WP_001024099.1 | SDR family oxidoreductase | - |
C248_RS10835 | 2175204..2175524 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
C248_RS10840 | 2175526..2176506 | + | 981 | WP_000019735.1 | CDF family zinc efflux transporter CzrB | - |
C248_RS10845 | 2176772..2177863 | + | 1092 | WP_000495673.1 | hypothetical protein | - |
- | 2178267..2178305 | + | 39 | - | - | Antitoxin |
C248_RS10850 | 2178361..2178465 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
C248_RS14500 | 2179145..2179303 | + | 159 | WP_001792784.1 | hypothetical protein | - |
C248_RS10855 | 2179739..2179831 | + | 93 | WP_000220902.1 | hypothetical protein | - |
C248_RS10860 | 2179961..2180818 | - | 858 | WP_000370942.1 | Cof-type HAD-IIB family hydrolase | - |
C248_RS10865 | 2180886..2181668 | - | 783 | WP_000908191.1 | ABC transporter ATP-binding protein | - |
C248_RS10870 | 2181958..2182566 | - | 609 | WP_000101714.1 | TIR domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T28256 WP_001802298.1 NC_018608:c2178465-2178361 [Staphylococcus aureus 08BA02176]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T28256 NC_018608:c2178465-2178361 [Staphylococcus aureus 08BA02176]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 39 bp
>AT28256 NC_018608:2178267-2178305 [Staphylococcus aureus 08BA02176]
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|