Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 5024557..5025143 Replicon chromosome
Accession NZ_CP126058
Organism Klebsiella pneumoniae subsp. pneumoniae strain CS00491

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag QM175_RS24360 Protein ID WP_002920800.1
Coordinates 5024557..5024925 (-) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag QM175_RS24365 Protein ID WP_004174006.1
Coordinates 5024922..5025143 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QM175_RS24340 (5020060) 5020060..5021130 - 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -
QM175_RS24345 (5021132) 5021132..5021977 - 846 WP_032434559.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
QM175_RS24350 (5021974) 5021974..5022861 - 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
QM175_RS24355 (5022968) 5022968..5024284 - 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
QM175_RS24360 (5024557) 5024557..5024925 - 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
QM175_RS24365 (5024922) 5024922..5025143 - 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QM175_RS24370 (5025307) 5025307..5026020 - 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
QM175_RS24375 (5026022) 5026022..5026789 - 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
QM175_RS24380 (5026786) 5026786..5028063 - 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
QM175_RS24385 (5028060) 5028060..5028986 - 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 5019323..5028063 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T282540 WP_002920800.1 NZ_CP126058:c5024925-5024557 [Klebsiella pneumoniae subsp. pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT282540 WP_004174006.1 NZ_CP126058:c5025143-5024922 [Klebsiella pneumoniae subsp. pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References