Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
Location | 2869379..2870068 | Replicon | chromosome |
Accession | NZ_CP126058 | ||
Organism | Klebsiella pneumoniae subsp. pneumoniae strain CS00491 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A331C6E2 |
Locus tag | QM175_RS13765 | Protein ID | WP_021469727.1 |
Coordinates | 2869751..2870068 (-) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A6B0N7G3 |
Locus tag | QM175_RS13760 | Protein ID | WP_020804705.1 |
Coordinates | 2869379..2869675 (-) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QM175_RS13745 (2865771) | 2865771..2867153 | + | 1383 | WP_004151222.1 | MFS transporter | - |
QM175_RS13750 (2867197) | 2867197..2868813 | + | 1617 | WP_004175961.1 | carbohydrate porin | - |
QM175_RS13755 (2868854) | 2868854..2869300 | - | 447 | WP_032435212.1 | hypothetical protein | - |
QM175_RS13760 (2869379) | 2869379..2869675 | - | 297 | WP_020804705.1 | NadS family protein | Antitoxin |
QM175_RS13765 (2869751) | 2869751..2870068 | - | 318 | WP_021469727.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QM175_RS13770 (2870275) | 2870275..2870502 | - | 228 | WP_002906690.1 | tautomerase PptA | - |
QM175_RS13775 (2870573) | 2870573..2871190 | - | 618 | WP_032425015.1 | glutathione S-transferase family protein | - |
QM175_RS13780 (2871268) | 2871268..2872119 | - | 852 | WP_072198177.1 | transporter substrate-binding domain-containing protein | - |
QM175_RS13785 (2872158) | 2872158..2872937 | - | 780 | WP_002906697.1 | amino acid ABC transporter ATP-binding protein | - |
QM175_RS13790 (2872921) | 2872921..2873847 | - | 927 | WP_032435210.1 | amino acid ABC transporter permease | - |
QM175_RS13795 (2873857) | 2873857..2874366 | - | 510 | WP_020802144.1 | GNAT family N-acetyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12221.10 Da Isoelectric Point: 10.2217
>T282533 WP_021469727.1 NZ_CP126058:c2870068-2869751 [Klebsiella pneumoniae subsp. pneumoniae]
MLTFIELQGFSKRRQVLLQDDEFRAFQEILINDPEAGDTISGTGGFRKIRWSRPGMGKRGGVRVIYYNVTKKGRIYLALI
YPKNEQDELNQEQKKMLRQVADLIN
MLTFIELQGFSKRRQVLLQDDEFRAFQEILINDPEAGDTISGTGGFRKIRWSRPGMGKRGGVRVIYYNVTKKGRIYLALI
YPKNEQDELNQEQKKMLRQVADLIN
Download Length: 318 bp
Antitoxin
Download Length: 99 a.a. Molecular weight: 11057.93 Da Isoelectric Point: 6.7277
>AT282533 WP_020804705.1 NZ_CP126058:c2869675-2869379 [Klebsiella pneumoniae subsp. pneumoniae]
MKDELFADLLASAEEMVRIEKGEQMLMEQHVHTFSEIDVKAIREATGLKQQDFAAAVGVSYELVKSWETKRRHPTGAARK
LLLLLQGNPLIINLLKVV
MKDELFADLLASAEEMVRIEKGEQMLMEQHVHTFSEIDVKAIREATGLKQQDFAAAVGVSYELVKSWETKRRHPTGAARK
LLLLLQGNPLIINLLKVV
Download Length: 297 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A331C6E2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6B0N7G3 |