Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/- |
Location | 2220182..2220840 | Replicon | chromosome |
Accession | NZ_CP125986 | ||
Organism | Pseudomonas rhodesiae strain 3.8 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A2G0X687 |
Locus tag | QMY54_RS13155 | Protein ID | WP_034114384.1 |
Coordinates | 2220182..2220526 (+) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QMY54_RS13160 | Protein ID | WP_034099046.1 |
Coordinates | 2220523..2220840 (+) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QMY54_RS13115 | 2215497..2215655 | + | 159 | WP_153529665.1 | hypothetical protein | - |
QMY54_RS13120 (QMY54_02624) | 2215955..2216242 | - | 288 | WP_034099056.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
QMY54_RS13125 (QMY54_02625) | 2216348..2216821 | - | 474 | WP_034114380.1 | hypothetical protein | - |
QMY54_RS13130 (QMY54_02626) | 2217022..2217654 | + | 633 | WP_143506428.1 | hypothetical protein | - |
QMY54_RS13135 (QMY54_02627) | 2218143..2218574 | - | 432 | WP_052229582.1 | helix-turn-helix domain-containing protein | - |
QMY54_RS13140 (QMY54_02628) | 2218719..2218874 | + | 156 | WP_143506426.1 | Arc family DNA-binding protein | - |
QMY54_RS13145 (QMY54_02629) | 2218948..2219178 | + | 231 | WP_236238667.1 | DUF3077 domain-containing protein | - |
QMY54_RS13150 (QMY54_02630) | 2219256..2220059 | + | 804 | WP_034114382.1 | phage antirepressor KilAC domain-containing protein | - |
QMY54_RS13155 (QMY54_02631) | 2220182..2220526 | + | 345 | WP_034114384.1 | toxin | Toxin |
QMY54_RS13160 (QMY54_02632) | 2220523..2220840 | + | 318 | WP_034099046.1 | transcriptional regulator | Antitoxin |
QMY54_RS13165 (QMY54_02633) | 2220892..2221317 | - | 426 | WP_005789662.1 | helix-turn-helix domain-containing protein | - |
QMY54_RS13170 (QMY54_02634) | 2221416..2221652 | + | 237 | WP_034099043.1 | YdaS family helix-turn-helix protein | - |
QMY54_RS13175 (QMY54_02635) | 2221738..2221857 | - | 120 | Protein_2021 | IS5/IS1182 family transposase | - |
QMY54_RS13180 (QMY54_02636) | 2222077..2222928 | + | 852 | WP_034114387.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2201373..2228971 | 27598 | |
- | flank | IS/Tn | - | - | 2221735..2221857 | 122 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13172.02 Da Isoelectric Point: 9.6563
>T282510 WP_034114384.1 NZ_CP125986:2220182-2220526 [Pseudomonas rhodesiae]
MKTVFFEMTSFTATVGDYLTDDEYRQLQTEMQANPEAGDVMPRTGGFRKLRWQDTRRGKGKRGGLRVIYYWLLNDGQFWM
FSIYDKDEMANLTAAQEKALKAAIDAELKKRGGK
MKTVFFEMTSFTATVGDYLTDDEYRQLQTEMQANPEAGDVMPRTGGFRKLRWQDTRRGKGKRGGLRVIYYWLLNDGQFWM
FSIYDKDEMANLTAAQEKALKAAIDAELKKRGGK
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|