Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 5358642..5359314 | Replicon | chromosome |
Accession | NZ_CP125961 | ||
Organism | Pseudomonas brassicacearum strain R401 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | QLH64_RS23245 | Protein ID | WP_057449633.1 |
Coordinates | 5358949..5359314 (-) | Length | 122 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QLH64_RS23240 | Protein ID | WP_057449632.1 |
Coordinates | 5358642..5358956 (-) | Length | 105 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLH64_RS23220 (QLH64_23220) | 5354021..5354740 | + | 720 | WP_057449629.1 | protocatechuate 3,4-dioxygenase subunit beta | - |
QLH64_RS23225 (QLH64_23225) | 5354753..5355355 | + | 603 | WP_057449630.1 | protocatechuate 3,4-dioxygenase subunit alpha | - |
QLH64_RS23230 (QLH64_23230) | 5355667..5358021 | + | 2355 | WP_236712350.1 | hypothetical protein | - |
QLH64_RS23235 (QLH64_23235) | 5358058..5358519 | + | 462 | WP_018607342.1 | Lrp/AsnC family transcriptional regulator | - |
QLH64_RS23240 (QLH64_23240) | 5358642..5358956 | - | 315 | WP_057449632.1 | XRE family transcriptional regulator | Antitoxin |
QLH64_RS23245 (QLH64_23245) | 5358949..5359314 | - | 366 | WP_057449633.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QLH64_RS23250 (QLH64_23250) | 5359678..5361360 | + | 1683 | WP_057449634.1 | NAD(P)/FAD-dependent oxidoreductase | - |
QLH64_RS23255 (QLH64_23255) | 5361373..5362167 | + | 795 | WP_057449635.1 | carbon-nitrogen hydrolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 14198.91 Da Isoelectric Point: 5.5738
>T282502 WP_057449633.1 NZ_CP125961:c5359314-5358949 [Pseudomonas brassicacearum]
MKWGVEYTDEFELWWDRLSESEQDSVQVSVMLLGDTGPYLGFPHTSDIKGSRHGNLRELRVQHAGRPYRVLYAFDPRRCA
ILLIGGDKTGQDRWYQQYVPLAERLYDEHLEVLKREGFDHG
MKWGVEYTDEFELWWDRLSESEQDSVQVSVMLLGDTGPYLGFPHTSDIKGSRHGNLRELRVQHAGRPYRVLYAFDPRRCA
ILLIGGDKTGQDRWYQQYVPLAERLYDEHLEVLKREGFDHG
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|