Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-MqsA |
Location | 7883..8532 | Replicon | plasmid pZM22-1 |
Accession | NZ_CP125948 | ||
Organism | Comamonas sp. ZM22 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | QMY55_RS24570 | Protein ID | WP_283489073.1 |
Coordinates | 8194..8532 (-) | Length | 113 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QMY55_RS24565 | Protein ID | WP_283489072.1 |
Coordinates | 7883..8197 (-) | Length | 105 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QMY55_RS24525 (QMY55_24525) | 2904..3140 | - | 237 | WP_283489080.1 | hypothetical protein | - |
QMY55_RS24530 (QMY55_24530) | 4147..4332 | - | 186 | WP_283489081.1 | integrase core domain-containing protein | - |
QMY55_RS24535 (QMY55_24535) | 4553..4897 | + | 345 | WP_283489082.1 | hypothetical protein | - |
QMY55_RS24540 (QMY55_24540) | 4906..5526 | - | 621 | WP_283489083.1 | hypothetical protein | - |
QMY55_RS24545 (QMY55_24545) | 5528..5899 | - | 372 | WP_283489068.1 | hypothetical protein | - |
QMY55_RS24550 (QMY55_24550) | 5912..6265 | - | 354 | WP_283489069.1 | hypothetical protein | - |
QMY55_RS24555 (QMY55_24555) | 6274..7185 | - | 912 | WP_283489070.1 | ATP-binding protein | - |
QMY55_RS24560 (QMY55_24560) | 7444..7764 | + | 321 | WP_283489071.1 | putative addiction module antidote protein | - |
QMY55_RS24565 (QMY55_24565) | 7883..8197 | - | 315 | WP_283489072.1 | transcriptional regulator | Antitoxin |
QMY55_RS24570 (QMY55_24570) | 8194..8532 | - | 339 | WP_283489073.1 | toxin | Toxin |
QMY55_RS24575 (QMY55_24575) | 8639..8866 | + | 228 | WP_283489074.1 | TraY domain-containing protein | - |
QMY55_RS24580 (QMY55_24580) | 8850..9110 | + | 261 | WP_283489075.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
QMY55_RS24585 (QMY55_24585) | 9135..9317 | - | 183 | WP_283489076.1 | hypothetical protein | - |
QMY55_RS24590 (QMY55_24590) | 9329..9967 | - | 639 | WP_283489077.1 | ParA family partition ATPase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..10050 | 10050 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 113 a.a. Molecular weight: 13117.05 Da Isoelectric Point: 9.9413
>T282492 WP_283489073.1 NZ_CP125948:c8532-8194 [Comamonas sp. ZM22]
MKAVFVELPAFERNRATYLNDDEFKEFQERLLKNPEAGDMIEGTGGLRKVRHGDPRRGKGTRGGLRVIYYWWSGGPQFWL
FTLYDKDELENLTPKQKAILKQLLKTELEARK
MKAVFVELPAFERNRATYLNDDEFKEFQERLLKNPEAGDMIEGTGGLRKVRHGDPRRGKGTRGGLRVIYYWWSGGPQFWL
FTLYDKDELENLTPKQKAILKQLLKTELEARK
Download Length: 339 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|