Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/- |
Location | 1831942..1832591 | Replicon | chromosome |
Accession | NZ_CP125947 | ||
Organism | Comamonas sp. ZM22 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | QMY55_RS08615 | Protein ID | WP_283488211.1 |
Coordinates | 1832253..1832591 (-) | Length | 113 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QMY55_RS08610 | Protein ID | WP_283488210.1 |
Coordinates | 1831942..1832256 (-) | Length | 105 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QMY55_RS08565 (QMY55_08565) | 1827153..1827542 | + | 390 | WP_283488201.1 | hypothetical protein | - |
QMY55_RS08570 (QMY55_08570) | 1827547..1828608 | + | 1062 | WP_283488202.1 | hypothetical protein | - |
QMY55_RS08575 (QMY55_08575) | 1828608..1829057 | + | 450 | WP_283488203.1 | hypothetical protein | - |
QMY55_RS08580 (QMY55_08580) | 1829054..1829479 | + | 426 | WP_283488204.1 | DUF4128 domain-containing protein | - |
QMY55_RS08585 (QMY55_08585) | 1829492..1829695 | + | 204 | WP_283488205.1 | hypothetical protein | - |
QMY55_RS08590 (QMY55_08590) | 1829789..1830514 | + | 726 | WP_283488206.1 | hypothetical protein | - |
QMY55_RS08595 (QMY55_08595) | 1830620..1831048 | + | 429 | WP_283488207.1 | hypothetical protein | - |
QMY55_RS08600 (QMY55_08600) | 1831524..1831706 | + | 183 | WP_283488208.1 | DUF2158 domain-containing protein | - |
QMY55_RS08605 (QMY55_08605) | 1831732..1831932 | - | 201 | WP_283488209.1 | hypothetical protein | - |
QMY55_RS08610 (QMY55_08610) | 1831942..1832256 | - | 315 | WP_283488210.1 | transcriptional regulator | Antitoxin |
QMY55_RS08615 (QMY55_08615) | 1832253..1832591 | - | 339 | WP_283488211.1 | toxin | Toxin |
QMY55_RS08620 (QMY55_08620) | 1832745..1833125 | - | 381 | WP_283488212.1 | Arc family DNA-binding protein | - |
QMY55_RS08625 (QMY55_08625) | 1833491..1834504 | + | 1014 | WP_283488213.1 | BRO family protein | - |
QMY55_RS08630 (QMY55_08630) | 1834596..1835066 | + | 471 | WP_283488214.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1796280..1844247 | 47967 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 113 a.a. Molecular weight: 13058.87 Da Isoelectric Point: 9.6389
>T282488 WP_283488211.1 NZ_CP125947:c1832591-1832253 [Comamonas sp. ZM22]
MKAVFVELPAFERYRSDYLDDENFRSLQHSLMKNPEAGDVIEGTGGLRKVRHADPRRGKGKRGGLRVIYYWWDGKGQFWL
FTLYDKDEMDDLSSKQKAALKSMLKAELEARQ
MKAVFVELPAFERYRSDYLDDENFRSLQHSLMKNPEAGDVIEGTGGLRKVRHADPRRGKGKRGGLRVIYYWWDGKGQFWL
FTLYDKDEMDDLSSKQKAALKSMLKAELEARQ
Download Length: 339 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|