Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprG-sprF/- |
| Location | 2312710..2312926 | Replicon | chromosome |
| Accession | NZ_CP125903 | ||
| Organism | Staphylococcus aureus strain CHAL1 | ||
Toxin (Protein)
| Gene name | SprG3 | Uniprot ID | - |
| Locus tag | QM337_RS11620 | Protein ID | WP_073392962.1 |
| Coordinates | 2312822..2312926 (-) | Length | 35 a.a. |
Antitoxin (RNA)
| Gene name | SprF1 | ||
| Locus tag | - | ||
| Coordinates | 2312710..2312765 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QM337_RS11595 | 2307803..2308123 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
| QM337_RS11600 | 2308125..2309105 | + | 981 | WP_283531627.1 | CDF family zinc efflux transporter CzrB | - |
| QM337_RS11605 | 2309371..2310462 | + | 1092 | WP_000495684.1 | hypothetical protein | - |
| QM337_RS11610 | 2310750..2312396 | + | 1647 | WP_000277709.1 | IS1182-like element ISSau3 family transposase | - |
| - | 2312710..2312765 | + | 56 | - | - | Antitoxin |
| QM337_RS11620 | 2312822..2312926 | - | 105 | WP_073392962.1 | hypothetical protein | Toxin |
| QM337_RS11625 | 2313606..2313764 | + | 159 | WP_001792784.1 | hypothetical protein | - |
| QM337_RS11630 | 2314423..2315280 | - | 858 | WP_000370937.1 | HAD family hydrolase | - |
| QM337_RS11635 | 2315348..2316130 | - | 783 | WP_000908186.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 2310750..2312396 | 1646 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3920.80 Da Isoelectric Point: 5.5724
>T282479 WP_073392962.1 NZ_CP125903:c2312926-2312822 [Staphylococcus aureus]
MLLLERTSMSDFEMLMIVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMIVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 56 bp
>AT282479 NZ_CP125903:2312710-2312765 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|