Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/-
Location 2145626..2146049 Replicon chromosome
Accession NZ_CP125903
Organism Staphylococcus aureus strain CHAL1

Toxin (Protein)


Gene name higB Uniprot ID A0A5S9I4Y6
Locus tag QM337_RS10675 Protein ID WP_001065091.1
Coordinates 2145798..2146049 (-) Length 84 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID A0A0E0VQM8
Locus tag QM337_RS10670 Protein ID WP_000028422.1
Coordinates 2145626..2145808 (-) Length 61 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QM337_RS10625 (2141012) 2141012..2142673 - 1662 WP_000625088.1 terminase large subunit -
QM337_RS10630 (2142670) 2142670..2143014 - 345 WP_000402904.1 hypothetical protein -
QM337_RS10635 (2143144) 2143144..2143443 - 300 WP_000988336.1 HNH endonuclease -
QM337_RS10640 (2143675) 2143675..2144091 - 417 WP_000590122.1 hypothetical protein -
QM337_RS10645 (2144119) 2144119..2144319 - 201 WP_000265043.1 DUF1514 family protein -
QM337_RS10650 (2144319) 2144319..2144468 - 150 WP_000595265.1 transcriptional activator RinB -
QM337_RS10655 (2144465) 2144465..2144851 - 387 WP_000592207.1 hypothetical protein -
QM337_RS10660 (2144848) 2144848..2145054 - 207 WP_000195803.1 DUF1381 domain-containing protein -
QM337_RS10665 (2145091) 2145091..2145633 - 543 WP_000185659.1 dUTP pyrophosphatase -
QM337_RS10670 (2145626) 2145626..2145808 - 183 WP_000028422.1 hypothetical protein Antitoxin
QM337_RS10675 (2145798) 2145798..2146049 - 252 WP_001065091.1 DUF1024 family protein Toxin
QM337_RS10680 (2146042) 2146042..2146209 - 168 WP_001624242.1 hypothetical protein -
QM337_RS10685 (2146221) 2146221..2146463 - 243 WP_000131366.1 SAV1978 family virulence-associated passenger protein -
QM337_RS10690 (2146467) 2146467..2146835 - 369 WP_000101274.1 SA1788 family PVL leukocidin-associated protein -
QM337_RS10695 (2146848) 2146848..2147157 - 310 Protein_2071 RusA family crossover junction endodeoxyribonuclease -
QM337_RS10700 (2147166) 2147166..2147384 - 219 WP_000338531.1 hypothetical protein -
QM337_RS10705 (2147391) 2147391..2148275 - 885 WP_000148316.1 DnaD domain protein -
QM337_RS10710 (2148305) 2148305..2148775 - 471 WP_000934764.1 single-stranded DNA-binding protein -
QM337_RS10715 (2148776) 2148776..2149393 - 618 WP_071621397.1 MBL fold metallo-hydrolase -
QM337_RS10720 (2149474) 2149474..2150394 - 921 WP_000138472.1 recombinase RecT -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - scn / chp / sak / sea / hlb / tsst-1 / groEL 2117958..2185922 67964


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1024

(1-82)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 84 a.a.        Molecular weight: 9349.22 Da        Isoelectric Point: 3.9473

>T282476 WP_001065091.1 NZ_CP125903:c2146049-2145798 [Staphylococcus aureus]
MNNREQIEQSVISASAYNGNDTEGLLKEIEDVYKKAQAFDEILEGMTNAIQHSVKEGVELDEAVGIMAGQVVYKYEEEQE
NEH

Download         Length: 252 bp

Antitoxin


Download         Length: 61 a.a.        Molecular weight: 6741.63 Da        Isoelectric Point: 4.2658

>AT282476 WP_000028422.1 NZ_CP125903:c2145808-2145626 [Staphylococcus aureus]
MSISVGDKVFNPETNSTLEIVQLVGDIRDTHYKLSDGSIISLIDFVVKPIHLIKEEQEND

Download         Length: 183 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5S9I4Y6

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VQM8

References