Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-MW1433/- |
| Location | 2122307..2122614 | Replicon | chromosome |
| Accession | NZ_CP125903 | ||
| Organism | Staphylococcus aureus strain CHAL1 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | Q2FWU9 |
| Locus tag | QM337_RS10525 | Protein ID | WP_011447039.1 |
| Coordinates | 2122438..2122614 (-) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | MW1433 | ||
| Locus tag | - | ||
| Coordinates | 2122307..2122446 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QM337_RS10485 (2117645) | 2117645..2117905 | + | 261 | WP_001791826.1 | hypothetical protein | - |
| QM337_RS10490 (2117958) | 2117958..2118308 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| QM337_RS10495 (2118994) | 2118994..2119443 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| QM337_RS10500 (2119538) | 2119538..2119873 | - | 336 | Protein_2032 | SH3 domain-containing protein | - |
| QM337_RS10505 (2120523) | 2120523..2121014 | - | 492 | WP_000919350.1 | staphylokinase | - |
| QM337_RS10510 (2121205) | 2121205..2121960 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| QM337_RS10515 (2121972) | 2121972..2122226 | - | 255 | WP_000611512.1 | phage holin | - |
| QM337_RS10520 (2122278) | 2122278..2122385 | + | 108 | WP_001791821.1 | hypothetical protein | - |
| - (2122307) | 2122307..2122446 | + | 140 | NuclAT_0 | - | Antitoxin |
| - (2122307) | 2122307..2122446 | + | 140 | NuclAT_0 | - | Antitoxin |
| - (2122307) | 2122307..2122446 | + | 140 | NuclAT_0 | - | Antitoxin |
| - (2122307) | 2122307..2122446 | + | 140 | NuclAT_0 | - | Antitoxin |
| QM337_RS10525 (2122438) | 2122438..2122614 | - | 177 | WP_011447039.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
| QM337_RS10530 (2122723) | 2122723..2123496 | - | 774 | WP_000750406.1 | staphylococcal enterotoxin type A | - |
| QM337_RS10535 (2123917) | 2123917..2124291 | - | 375 | WP_000340977.1 | hypothetical protein | - |
| QM337_RS10540 (2124347) | 2124347..2124634 | - | 288 | WP_001040259.1 | hypothetical protein | - |
| QM337_RS10545 (2124681) | 2124681..2124833 | - | 153 | WP_001153681.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | scn / chp / sak / sea / hlb / tsst-1 / groEL | 2117958..2185922 | 67964 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T282473 WP_011447039.1 NZ_CP125903:c2122614-2122438 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 140 bp
>AT282473 NZ_CP125903:2122307-2122446 [Staphylococcus aureus]
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
