Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1964993..1965173 | Replicon | chromosome |
| Accession | NZ_CP125903 | ||
| Organism | Staphylococcus aureus strain CHAL1 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | QM337_RS09545 | Protein ID | WP_001801861.1 |
| Coordinates | 1964993..1965088 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1965116..1965173 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QM337_RS09515 | 1960137..1960763 | + | 627 | WP_000669038.1 | hypothetical protein | - |
| QM337_RS09520 | 1960804..1961148 | + | 345 | WP_000627550.1 | DUF3969 family protein | - |
| QM337_RS09525 | 1961246..1961818 | + | 573 | WP_000414222.1 | hypothetical protein | - |
| QM337_RS09530 | 1961967..1963334 | - | 1368 | WP_001093574.1 | FRG domain-containing protein | - |
| QM337_RS09535 | 1963334..1963903 | - | 570 | WP_000125075.1 | ImmA/IrrE family metallo-endopeptidase | - |
| QM337_RS09540 | 1964096..1964542 | - | 447 | WP_000747804.1 | DUF1433 domain-containing protein | - |
| QM337_RS09545 | 1964993..1965088 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1965116..1965173 | - | 58 | - | - | Antitoxin |
| QM337_RS09550 | 1965211..1965312 | + | 102 | WP_001791232.1 | hypothetical protein | - |
| QM337_RS09555 | 1965487..1965929 | - | 443 | Protein_1881 | DUF1433 domain-containing protein | - |
| QM337_RS09560 | 1965929..1966372 | - | 444 | WP_000731421.1 | DUF1433 domain-containing protein | - |
| QM337_RS09565 | 1966372..1966814 | - | 443 | Protein_1883 | DUF1433 domain-containing protein | - |
| QM337_RS09570 | 1967339..1969759 | + | 2421 | WP_283531521.1 | polysaccharide lyase 8 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T282471 WP_001801861.1 NZ_CP125903:1964993-1965088 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
Antitoxin
Download Length: 58 bp
>AT282471 NZ_CP125903:c1965173-1965116 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|