Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/-
Location 1621956..1622379 Replicon chromosome
Accession NZ_CP125903
Organism Staphylococcus aureus strain CHAL1

Toxin (Protein)


Gene name higB Uniprot ID A0A6B5KJM6
Locus tag QM337_RS07805 Protein ID WP_001065110.1
Coordinates 1622128..1622379 (-) Length 84 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID A0A0E1X568
Locus tag QM337_RS07800 Protein ID WP_000028425.1
Coordinates 1621956..1622138 (-) Length 61 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QM337_RS07760 (1617349) 1617349..1617639 - 291 WP_000665205.1 VRR-NUC domain-containing protein -
QM337_RS07765 (1617773) 1617773..1617877 + 105 WP_015978074.1 hypothetical protein -
QM337_RS07770 (1617980) 1617980..1620427 - 2448 WP_283531377.1 virulence-associated E family protein -
QM337_RS07775 (1620480) 1620480..1620680 - 201 WP_000265258.1 DUF1514 family protein -
QM337_RS07780 (1620748) 1620748..1620900 - 153 WP_000595237.1 transcriptional activator RinB -
QM337_RS07785 (1620893) 1620893..1621129 - 237 WP_000483477.1 hypothetical protein -
QM337_RS07790 (1621154) 1621154..1621390 - 237 WP_000195806.1 DUF1381 domain-containing protein -
QM337_RS07795 (1621427) 1621427..1621963 - 537 WP_000185703.1 dUTPase -
QM337_RS07800 (1621956) 1621956..1622138 - 183 WP_000028425.1 hypothetical protein Antitoxin
QM337_RS07805 (1622128) 1622128..1622379 - 252 WP_001065110.1 DUF1024 family protein Toxin
QM337_RS07810 (1622394) 1622394..1622636 - 243 WP_000132193.1 SAV1978 family virulence-associated passenger protein -
QM337_RS07815 (1622651) 1622651..1622851 - 201 WP_000235324.1 hypothetical protein -
QM337_RS07820 (1622854) 1622854..1623111 - 258 WP_000022730.1 DUF3310 domain-containing protein -
QM337_RS07825 (1623111) 1623111..1623512 - 402 WP_000113974.1 PVL family protein -
QM337_RS07830 (1623512) 1623512..1623697 - 186 WP_001164629.1 DUF3113 family protein -
QM337_RS07835 (1623710) 1623710..1625662 - 1953 WP_001802096.1 DNA polymerase -
QM337_RS07840 (1625730) 1625730..1626287 - 558 WP_000645048.1 DUF2815 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - gnd 1590431..1661754 71323


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1024

(1-82)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 84 a.a.        Molecular weight: 9405.32 Da        Isoelectric Point: 3.8051

>T282468 WP_001065110.1 NZ_CP125903:c1622379-1622128 [Staphylococcus aureus]
MNNREQIEQSVISASAYNGNDTEGLLKEIEDVYKKARAFDEILEGLPNAMQDALKEDIGLDEAVGIMTGQVVYKYEEEQE
NEY

Download         Length: 252 bp

Antitoxin


Download         Length: 61 a.a.        Molecular weight: 6781.65 Da        Isoelectric Point: 4.4421

>AT282468 WP_000028425.1 NZ_CP125903:c1622138-1621956 [Staphylococcus aureus]
MSISVGDKVYNHETNESLEIVQLVGDIRDTHYKLSDGSIISLIDFVIKPIHLIKEAQEND

Download         Length: 183 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6B5KJM6

Antitoxin

Source ID Structure
AlphaFold DB A0A0E1X568

References