Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2459907..2460091 | Replicon | chromosome |
Accession | NZ_CP125901 | ||
Organism | Staphylococcus aureus strain CHAL2 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2U0ISP5 |
Locus tag | QM338_RS12370 | Protein ID | WP_000482652.1 |
Coordinates | 2459984..2460091 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2459907..2459967 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QM338_RS12355 | 2455362..2455493 | - | 132 | WP_223197975.1 | hypothetical protein | - |
QM338_RS12360 | 2455760..2457493 | - | 1734 | WP_000486487.1 | ABC transporter ATP-binding protein | - |
QM338_RS12365 | 2457518..2459281 | - | 1764 | WP_001064825.1 | ABC transporter ATP-binding protein | - |
- | 2459907..2459967 | + | 61 | - | - | Antitoxin |
QM338_RS12370 | 2459984..2460091 | - | 108 | WP_000482652.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
QM338_RS12375 | 2460225..2460611 | - | 387 | WP_283512296.1 | flippase GtxA | - |
QM338_RS12380 | 2460879..2462021 | + | 1143 | WP_031765234.1 | glycerate kinase | - |
QM338_RS12385 | 2462081..2462740 | + | 660 | WP_000831298.1 | membrane protein | - |
QM338_RS12390 | 2462922..2464133 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
QM338_RS12395 | 2464256..2464729 | - | 474 | WP_283512297.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T282465 WP_000482652.1 NZ_CP125901:c2460091-2459984 [Staphylococcus aureus]
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT282465 NZ_CP125901:2459907-2459967 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|