Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprG-sprF/- |
| Location | 2176725..2176941 | Replicon | chromosome |
| Accession | NZ_CP125901 | ||
| Organism | Staphylococcus aureus strain CHAL2 | ||
Toxin (Protein)
| Gene name | SprG3 | Uniprot ID | Q2FWA7 |
| Locus tag | QM338_RS10880 | Protein ID | WP_001802298.1 |
| Coordinates | 2176837..2176941 (-) | Length | 35 a.a. |
Antitoxin (RNA)
| Gene name | SprF1 | ||
| Locus tag | - | ||
| Coordinates | 2176725..2176780 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QM338_RS10855 | 2172931..2173596 | - | 666 | WP_001024095.1 | SDR family oxidoreductase | - |
| QM338_RS10860 | 2173748..2174068 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
| QM338_RS10865 | 2174070..2175047 | + | 978 | WP_000019734.1 | CDF family zinc efflux transporter CzrB | - |
| QM338_RS10870 | 2175313..2176404 | + | 1092 | WP_000495669.1 | hypothetical protein | - |
| - | 2176725..2176780 | + | 56 | - | - | Antitoxin |
| QM338_RS10880 | 2176837..2176941 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
| QM338_RS10885 | 2177458..2177628 | + | 171 | WP_001792292.1 | transposase | - |
| QM338_RS10890 | 2177621..2177779 | + | 159 | WP_001792784.1 | hypothetical protein | - |
| QM338_RS10895 | 2178437..2179294 | - | 858 | WP_000370925.1 | Cof-type HAD-IIB family hydrolase | - |
| QM338_RS10900 | 2179362..2180144 | - | 783 | WP_000908182.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T282462 WP_001802298.1 NZ_CP125901:c2176941-2176837 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 56 bp
>AT282462 NZ_CP125901:2176725-2176780 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|