Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF1/- |
| Location | 2004216..2004523 | Replicon | chromosome |
| Accession | NZ_CP125901 | ||
| Organism | Staphylococcus aureus strain CHAL2 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | Q2FWU9 |
| Locus tag | QM338_RS09930 | Protein ID | WP_011447039.1 |
| Coordinates | 2004347..2004523 (-) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF1 | ||
| Locus tag | - | ||
| Coordinates | 2004216..2004355 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QM338_RS09890 (1999561) | 1999561..1999821 | + | 261 | WP_001791826.1 | hypothetical protein | - |
| QM338_RS09895 (1999874) | 1999874..2000224 | - | 351 | WP_000702262.1 | complement inhibitor SCIN-A | - |
| QM338_RS09900 (2000907) | 2000907..2001356 | + | 450 | WP_000727645.1 | chemotaxis-inhibiting protein CHIPS | - |
| QM338_RS09905 (2001451) | 2001451..2001785 | - | 335 | Protein_1912 | SH3 domain-containing protein | - |
| QM338_RS09910 (2002432) | 2002432..2002923 | - | 492 | WP_000920042.1 | staphylokinase | - |
| QM338_RS09915 (2003114) | 2003114..2003869 | - | 756 | WP_000861026.1 | CHAP domain-containing protein | - |
| QM338_RS09920 (2003881) | 2003881..2004135 | - | 255 | WP_000611512.1 | phage holin | - |
| QM338_RS09925 (2004187) | 2004187..2004294 | + | 108 | WP_031762631.1 | hypothetical protein | - |
| - (2004216) | 2004216..2004355 | + | 140 | NuclAT_0 | - | Antitoxin |
| - (2004216) | 2004216..2004355 | + | 140 | NuclAT_0 | - | Antitoxin |
| - (2004216) | 2004216..2004355 | + | 140 | NuclAT_0 | - | Antitoxin |
| - (2004216) | 2004216..2004355 | + | 140 | NuclAT_0 | - | Antitoxin |
| QM338_RS09930 (2004347) | 2004347..2004523 | - | 177 | WP_011447039.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
| QM338_RS09935 (2004726) | 2004726..2005481 | - | 756 | WP_029729062.1 | staphylococcal enterotoxin type P | - |
| QM338_RS09940 (2005919) | 2005919..2006293 | - | 375 | WP_000340977.1 | hypothetical protein | - |
| QM338_RS09945 (2006349) | 2006349..2006638 | - | 290 | Protein_1920 | hypothetical protein | - |
| QM338_RS09950 (2006715) | 2006715..2006840 | - | 126 | WP_283512276.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | scn / chp / sak / see / hlb / groEL | 1999874..2051412 | 51538 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T282457 WP_011447039.1 NZ_CP125901:c2004523-2004347 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 140 bp
>AT282457 NZ_CP125901:2004216-2004355 [Staphylococcus aureus]
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAGTGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAGTGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
