Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2425181..2425365 | Replicon | chromosome |
Accession | NZ_CP125899 | ||
Organism | Staphylococcus aureus strain CHAL3 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | QM339_RS12060 | Protein ID | WP_000482647.1 |
Coordinates | 2425258..2425365 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2425181..2425241 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QM339_RS12040 | 2420767..2420934 | - | 168 | WP_031785511.1 | hypothetical protein | - |
QM339_RS12045 | 2421165..2422898 | - | 1734 | WP_000488492.1 | ABC transporter ATP-binding protein | - |
QM339_RS12050 | 2422947..2424686 | - | 1740 | WP_001064831.1 | ABC transporter ATP-binding protein | - |
QM339_RS12055 | 2425064..2425231 | - | 168 | WP_000301894.1 | hypothetical protein | - |
- | 2425181..2425241 | + | 61 | - | - | Antitoxin |
QM339_RS12060 | 2425258..2425365 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
QM339_RS12065 | 2425499..2425885 | - | 387 | WP_000779354.1 | flippase GtxA | - |
QM339_RS12070 | 2426153..2427295 | + | 1143 | WP_001176860.1 | glycerate kinase | - |
QM339_RS12075 | 2427355..2428014 | + | 660 | WP_000831298.1 | membrane protein | - |
QM339_RS12080 | 2428194..2429405 | + | 1212 | WP_001191975.1 | multidrug effflux MFS transporter | - |
QM339_RS12085 | 2429528..2430001 | - | 474 | WP_000456491.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T282452 WP_000482647.1 NZ_CP125899:c2425365-2425258 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT282452 NZ_CP125899:2425181-2425241 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|