Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF1/- |
| Location | 838337..838675 | Replicon | chromosome |
| Accession | NZ_CP125899 | ||
| Organism | Staphylococcus aureus strain CHAL3 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | Q2FWU9 |
| Locus tag | QM339_RS04060 | Protein ID | WP_011447039.1 |
| Coordinates | 838337..838513 (+) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF1 | ||
| Locus tag | - | ||
| Coordinates | 838501..838675 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QM339_RS04040 | 833572..837357 | + | 3786 | Protein_783 | phage tail spike protein | - |
| QM339_RS04045 | 837347..837499 | + | 153 | WP_001153681.1 | hypothetical protein | - |
| QM339_RS04050 | 837546..837833 | + | 288 | WP_001040261.1 | hypothetical protein | - |
| QM339_RS04055 | 837891..838187 | + | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| QM339_RS04060 | 838337..838513 | + | 177 | WP_011447039.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
| - | 838501..838675 | - | 175 | - | - | Antitoxin |
| QM339_RS04070 | 838725..838979 | + | 255 | WP_000611512.1 | phage holin | - |
| QM339_RS04075 | 838991..839746 | + | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| QM339_RS04080 | 839937..840428 | + | 492 | WP_000919350.1 | staphylokinase | - |
| QM339_RS04085 | 841078..841413 | + | 336 | Protein_792 | SH3 domain-containing protein | - |
| QM339_RS04090 | 841508..841957 | - | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| QM339_RS04095 | 842642..842992 | + | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| QM339_RS04100 | 843045..843305 | - | 261 | WP_001791826.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | sak / chp / scn | 803361..842992 | 39631 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T282444 WP_011447039.1 NZ_CP125899:838337-838513 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 175 bp
>AT282444 NZ_CP125899:c838675-838501 [Staphylococcus aureus]
ATTTGATATTTATATTATGGTGTGTTAATTTATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCC
GTTAAAAAGACGGTGGCTATTTTAGATTAAAGATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGAT
GGTTATTTTTTATTG
ATTTGATATTTATATTATGGTGTGTTAATTTATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCC
GTTAAAAAGACGGTGGCTATTTTAGATTAAAGATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGAT
GGTTATTTTTTATTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|