Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2199041..2199258 | Replicon | chromosome |
Accession | NZ_CP125897 | ||
Organism | Staphylococcus aureus strain CHAL4 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | QM341_RS11105 | Protein ID | WP_001802298.1 |
Coordinates | 2199154..2199258 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF4 | ||
Locus tag | - | ||
Coordinates | 2199041..2199096 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QM341_RS11080 | 2195178..2195843 | - | 666 | WP_001024094.1 | SDR family oxidoreductase | - |
QM341_RS11085 | 2195995..2196315 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
QM341_RS11090 | 2196317..2197297 | + | 981 | WP_000019744.1 | CDF family zinc efflux transporter CzrB | - |
QM341_RS11095 | 2197563..2198654 | + | 1092 | WP_000495671.1 | lytic regulatory protein | - |
- | 2199041..2199096 | + | 56 | - | - | Antitoxin |
QM341_RS11105 | 2199154..2199258 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
QM341_RS11110 | 2199419..2199902 | - | 484 | Protein_2148 | recombinase family protein | - |
QM341_RS11115 | 2199945..2201081 | - | 1137 | WP_000115564.1 | SAP domain-containing protein | - |
QM341_RS11120 | 2201370..2201462 | + | 93 | WP_001790138.1 | hypothetical protein | - |
QM341_RS11125 | 2202167..2203024 | - | 858 | WP_000370924.1 | HAD family hydrolase | - |
QM341_RS11130 | 2203092..2203874 | - | 783 | WP_000908176.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T282439 WP_001802298.1 NZ_CP125897:c2199258-2199154 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 56 bp
>AT282439 NZ_CP125897:2199041-2199096 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|