Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 358370..358677 | Replicon | chromosome |
Accession | NZ_CP125897 | ||
Organism | Staphylococcus aureus strain CHAL4 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | A0A6B5C9Y4 |
Locus tag | QM341_RS01740 | Protein ID | WP_072357969.1 |
Coordinates | 358370..358546 (+) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 358538..358677 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QM341_RS01720 (353605) | 353605..357390 | + | 3786 | WP_031926986.1 | phage tail spike protein | - |
QM341_RS01725 (357380) | 357380..357532 | + | 153 | WP_001153681.1 | hypothetical protein | - |
QM341_RS01730 (357579) | 357579..357866 | + | 288 | WP_001040254.1 | hypothetical protein | - |
QM341_RS01735 (357924) | 357924..358220 | + | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
QM341_RS01740 (358370) | 358370..358546 | + | 177 | WP_072357969.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
- (358538) | 358538..358677 | - | 140 | NuclAT_1 | - | Antitoxin |
- (358538) | 358538..358677 | - | 140 | NuclAT_1 | - | Antitoxin |
- (358538) | 358538..358677 | - | 140 | NuclAT_1 | - | Antitoxin |
- (358538) | 358538..358677 | - | 140 | NuclAT_1 | - | Antitoxin |
QM341_RS01745 (358599) | 358599..358706 | - | 108 | WP_031762631.1 | hypothetical protein | - |
QM341_RS01750 (358758) | 358758..359012 | + | 255 | WP_000611512.1 | phage holin | - |
QM341_RS01755 (359024) | 359024..359779 | + | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
QM341_RS01760 (360313) | 360313..360435 | + | 123 | WP_000346420.1 | hypothetical protein | - |
QM341_RS01765 (360677) | 360677..361504 | - | 828 | WP_000136020.1 | alpha/beta hydrolase | - |
QM341_RS01770 (361577) | 361577..362776 | - | 1200 | WP_000286484.1 | NADH-dependent flavin oxidoreductase | - |
QM341_RS01775 (362872) | 362872..362964 | + | 93 | WP_001801779.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 319336..359779 | 40443 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6863.47 Da Isoelectric Point: 10.6777
>T282430 WP_072357969.1 NZ_CP125897:358370-358546 [Staphylococcus aureus]
MDRWWLSEYKEVVPMLALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMLALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 140 bp
>AT282430 NZ_CP125897:c358677-358538 [Staphylococcus aureus]
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAGTGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAGTGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|