Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2430177..2430361 | Replicon | chromosome |
Accession | NZ_CP125895 | ||
Organism | Staphylococcus aureus strain CHAL5 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2U0ISP5 |
Locus tag | QM342_RS12055 | Protein ID | WP_000482652.1 |
Coordinates | 2430254..2430361 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2430177..2430237 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QM342_RS12040 | 2425632..2425799 | - | 168 | WP_001789205.1 | hypothetical protein | - |
QM342_RS12045 | 2426030..2427763 | - | 1734 | WP_049307645.1 | ABC transporter ATP-binding protein | - |
QM342_RS12050 | 2427788..2429551 | - | 1764 | WP_001064837.1 | ABC transporter ATP-binding protein | - |
- | 2430177..2430237 | + | 61 | - | - | Antitoxin |
QM342_RS12055 | 2430254..2430361 | - | 108 | WP_000482652.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
QM342_RS12060 | 2430495..2430881 | - | 387 | WP_000779357.1 | flippase GtxA | - |
QM342_RS12065 | 2431150..2432292 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
QM342_RS12070 | 2432352..2433011 | + | 660 | WP_000831298.1 | membrane protein | - |
QM342_RS12075 | 2433193..2434404 | + | 1212 | WP_001191922.1 | multidrug effflux MFS transporter | - |
QM342_RS12080 | 2434527..2435000 | - | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T282426 WP_000482652.1 NZ_CP125895:c2430361-2430254 [Staphylococcus aureus]
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT282426 NZ_CP125895:2430177-2430237 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|