Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2145159..2145376 | Replicon | chromosome |
Accession | NZ_CP125895 | ||
Organism | Staphylococcus aureus strain CHAL5 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | QM342_RS10575 | Protein ID | WP_001802298.1 |
Coordinates | 2145272..2145376 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF4 | ||
Locus tag | - | ||
Coordinates | 2145159..2145214 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QM342_RS10550 | 2141353..2142018 | - | 666 | WP_001024095.1 | SDR family oxidoreductase | - |
QM342_RS10555 | 2142170..2142490 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
QM342_RS10560 | 2142492..2143472 | + | 981 | WP_000019744.1 | CDF family zinc efflux transporter CzrB | - |
QM342_RS10565 | 2143738..2144829 | + | 1092 | WP_000495683.1 | hypothetical protein | - |
- | 2145159..2145214 | + | 56 | - | - | Antitoxin |
QM342_RS10575 | 2145272..2145376 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
QM342_RS10580 | 2145537..2146020 | - | 484 | Protein_2042 | recombinase family protein | - |
QM342_RS10585 | 2146063..2147199 | - | 1137 | WP_000115564.1 | SAP domain-containing protein | - |
QM342_RS10590 | 2147488..2147580 | + | 93 | WP_001790138.1 | hypothetical protein | - |
QM342_RS10595 | 2148285..2149142 | - | 858 | WP_000370924.1 | HAD family hydrolase | - |
QM342_RS10600 | 2149210..2149992 | - | 783 | WP_283483101.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T282424 WP_001802298.1 NZ_CP125895:c2145376-2145272 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 56 bp
>AT282424 NZ_CP125895:2145159-2145214 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|