Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 1972794..1973093 | Replicon | chromosome |
Accession | NZ_CP125895 | ||
Organism | Staphylococcus aureus strain CHAL5 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | QM342_RS09625 | Protein ID | WP_011447039.1 |
Coordinates | 1972917..1973093 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 1972794..1972849 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QM342_RS09585 | 1968128..1968388 | + | 261 | WP_001791826.1 | hypothetical protein | - |
QM342_RS09590 | 1968441..1968791 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
QM342_RS09595 | 1969474..1969923 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
QM342_RS09600 | 1970018..1970352 | - | 335 | Protein_1851 | SH3 domain-containing protein | - |
QM342_RS09605 | 1971002..1971493 | - | 492 | WP_000919350.1 | staphylokinase | - |
QM342_RS09610 | 1971684..1972439 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
QM342_RS09615 | 1972451..1972705 | - | 255 | WP_000611512.1 | phage holin | - |
QM342_RS09620 | 1972757..1972864 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 1972786..1972925 | + | 140 | NuclAT_0 | - | - |
- | 1972786..1972925 | + | 140 | NuclAT_0 | - | - |
- | 1972786..1972925 | + | 140 | NuclAT_0 | - | - |
- | 1972786..1972925 | + | 140 | NuclAT_0 | - | - |
- | 1972794..1972849 | + | 56 | - | - | Antitoxin |
QM342_RS09625 | 1972917..1973093 | - | 177 | WP_011447039.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
QM342_RS09630 | 1973243..1973539 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
QM342_RS09635 | 1973597..1973884 | - | 288 | WP_001040261.1 | hypothetical protein | - |
QM342_RS09640 | 1973931..1974083 | - | 153 | WP_001153681.1 | hypothetical protein | - |
QM342_RS09645 | 1974073..1977858 | - | 3786 | WP_000582165.1 | phage tail spike protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / chp / sak / hlb / groEL | 1968441..2021065 | 52624 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T282419 WP_011447039.1 NZ_CP125895:c1973093-1972917 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 56 bp
>AT282419 NZ_CP125895:1972794-1972849 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|