Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/COG4683-HTH_37
Location 334103..334605 Replicon chromosome
Accession NZ_CP125879
Organism Auritidibacter ignavus strain BABAE-8

Toxin (Protein)


Gene name HigB2 Uniprot ID -
Locus tag QM395_RS01440 Protein ID WP_233242926.1
Coordinates 334414..334605 (-) Length 64 a.a.

Antitoxin (Protein)


Gene name HigA2 Uniprot ID -
Locus tag QM395_RS01435 Protein ID WP_110100035.1
Coordinates 334103..334408 (-) Length 102 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QM395_RS01405 (QM395_01405) 329386..329772 - 387 WP_110100203.1 hypothetical protein -
QM395_RS01410 (QM395_01410) 330014..330319 - 306 WP_283518354.1 hypothetical protein -
QM395_RS01415 (QM395_01415) 330531..331286 - 756 WP_279673610.1 sulfite exporter TauE/SafE family protein -
QM395_RS01420 (QM395_01420) 332330..333094 - 765 WP_283518357.1 sulfite exporter TauE/SafE family protein -
QM395_RS01425 (QM395_01425) 333360..333734 - 375 WP_283518359.1 hypothetical protein -
QM395_RS01430 (QM395_01430) 333719..334003 - 285 WP_283518361.1 hypothetical protein -
QM395_RS01435 (QM395_01435) 334103..334408 - 306 WP_110100035.1 helix-turn-helix transcriptional regulator Antitoxin
QM395_RS01440 (QM395_01440) 334414..334605 - 192 WP_233242926.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QM395_RS01445 (QM395_01445) 334872..335597 - 726 WP_283518363.1 hypothetical protein -
QM395_RS01450 (QM395_01450) 336141..336389 - 249 WP_283518365.1 hypothetical protein -
QM395_RS01455 (QM395_01455) 336394..336678 - 285 WP_283518367.1 hypothetical protein -
QM395_RS01460 (QM395_01460) 336691..337116 - 426 WP_110100005.1 type II toxin-antitoxin system VapC family toxin -
QM395_RS01465 (QM395_01465) 337113..337346 - 234 WP_110100006.1 Arc family DNA-binding protein -
QM395_RS01470 (QM395_01470) 337494..338579 - 1086 WP_283518370.1 redox-regulated ATPase YchF -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(1-53)

Antitoxin

Cro/C1-type helix-turn-helix domain

(34-88)


Sequences

Toxin        


Download         Length: 64 a.a.        Molecular weight: 7440.62 Da        Isoelectric Point: 9.9218

>T282413 WP_233242926.1 NZ_CP125879:c334605-334414 [Auritidibacter ignavus]
MKELRPGSSGRSELRVLFAFDPERVAIMLIAGDKIGDWKRWYKKHISLADDLFDEHLARLRRE

Download         Length: 192 bp

Antitoxin


Download         Length: 102 a.a.        Molecular weight: 11380.05 Da        Isoelectric Point: 9.5598

>AT282413 WP_110100035.1 NZ_CP125879:c334408-334103 [Auritidibacter ignavus]
MAKNLKDFVAEHPVDRGRVEVHKKRMLAEVRAYRLRELREQAGLTQAQLAERIGVGQRQVSKIEQGDLDSAKVGTIRSYL
EAVGGELSLEYVMGDQRMQVA

Download         Length: 306 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References