Detailed information of TA system TA282340

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 167310..167736
• Replicon: plasmid pGYB02-2
• Accession: NZ_CP125736
• Organism: Klebsiella pneumoniae strain GYB02

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: QMW18_RS27130
• Protein ID: WP_001372321.1
• Coordinates: 167611..167736 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	167310..167534 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
QMW18_RS27095 (162414)	162414..162875	-	462	Protein_199	hypothetical protein	-
QMW18_RS27100 (163177)	163177..163704	+	528	WP_000290834.1	single-stranded DNA-binding protein	-
QMW18_RS27105 (163762)	163762..163995	+	234	WP_000006003.1	DUF905 family protein	-
QMW18_RS27110 (164056)	164056..166079	+	2024	Protein_202	ParB/RepB/Spo0J family partition protein	-
QMW18_RS27115 (166148)	166148..166582	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
QMW18_RS27120 (166579)	166579..167298	+	720	WP_001276217.1	plasmid SOS inhibition protein A	-
- (167310)	167310..167534	+	225	NuclAT_0	-	Antitoxin
- (167310)	167310..167534	+	225	NuclAT_0	-	Antitoxin
- (167310)	167310..167534	+	225	NuclAT_0	-	Antitoxin
- (167310)	167310..167534	+	225	NuclAT_0	-	Antitoxin
QMW18_RS27125 (167520)	167520..167669	+	150	Protein_205	plasmid maintenance protein Mok	-
QMW18_RS27130 (167611)	167611..167736	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
QMW18_RS27135 (168055)	168055..168351	-	297	Protein_207	hypothetical protein	-
QMW18_RS27140 (168651)	168651..168947	+	297	WP_001272251.1	hypothetical protein	-
QMW18_RS27145 (169058)	169058..169879	+	822	WP_001234445.1	DUF932 domain-containing protein	-
QMW18_RS27150 (170176)	170176..170823	-	648	WP_015059008.1	transglycosylase SLT domain-containing protein	-
QMW18_RS27155 (171100)	171100..171483	+	384	WP_000124981.1	conjugal transfer relaxosome DNA-binding protein TraM	-
QMW18_RS27160 (171674)	171674..172360	+	687	WP_015059009.1	PAS domain-containing protein	-
QMW18_RS27165 (172454)	172454..172681	+	228	WP_001254386.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	aadA5 / qacE / sul1 / blaNDM-5 / tet(B) / qepA1 / rmtB / blaTEM-1B / blaCTX-M-55	iucA / iucB / iucC / iucD / iutA	1..211607	211607

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T282340 WP_001372321.1 NZ_CP125736:167611-167736 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT282340 NZ_CP125736:167310-167534 [Klebsiella pneumoniae]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin