Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 132114..132367 | Replicon | plasmid pGYB02-2 |
| Accession | NZ_CP125736 | ||
| Organism | Klebsiella pneumoniae strain GYB02 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | QMW18_RS26895 | Protein ID | WP_001312851.1 |
| Coordinates | 132218..132367 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 132114..132173 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QMW18_RS26870 (128841) | 128841..129587 | + | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
| QMW18_RS26875 (129642) | 129642..130202 | + | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
| QMW18_RS26880 (130334) | 130334..130534 | + | 201 | WP_015059022.1 | hypothetical protein | - |
| QMW18_RS26885 (130920) | 130920..131519 | + | 600 | WP_032083981.1 | PIN domain-containing protein | - |
| QMW18_RS26890 (131581) | 131581..131913 | + | 333 | WP_152916585.1 | hypothetical protein | - |
| - (132114) | 132114..132173 | - | 60 | NuclAT_4 | - | Antitoxin |
| - (132114) | 132114..132173 | - | 60 | NuclAT_4 | - | Antitoxin |
| - (132114) | 132114..132173 | - | 60 | NuclAT_4 | - | Antitoxin |
| - (132114) | 132114..132173 | - | 60 | NuclAT_4 | - | Antitoxin |
| QMW18_RS26895 (132218) | 132218..132367 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| QMW18_RS26900 (132651) | 132651..132899 | + | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
| QMW18_RS26905 (133144) | 133144..133218 | + | 75 | WP_001375168.1 | RepA leader peptide Tap | - |
| QMW18_RS26910 (133211) | 133211..134068 | + | 858 | WP_032495102.1 | incFII family plasmid replication initiator RepA | - |
| QMW18_RS26915 (135007) | 135007..135399 | + | 393 | WP_000616804.1 | histidine phosphatase family protein | - |
| QMW18_RS26920 (135392) | 135392..135649 | + | 258 | WP_230133887.1 | CPBP family intramembrane metalloprotease | - |
| QMW18_RS26925 (135742) | 135742..135999 | + | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| QMW18_RS26930 (135932) | 135932..136333 | + | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| QMW18_RS26935 (136582) | 136582..136997 | + | 416 | Protein_167 | IS1-like element IS1B family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | aadA5 / qacE / sul1 / blaNDM-5 / tet(B) / qepA1 / rmtB / blaTEM-1B / blaCTX-M-55 | iucA / iucB / iucC / iucD / iutA | 1..211607 | 211607 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T282337 WP_001312851.1 NZ_CP125736:132218-132367 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT282337 NZ_CP125736:c132173-132114 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
