Detailed information of TA system TA282334

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 92506..92739
• Replicon: plasmid pGYB02-2
• Accession: NZ_CP125736
• Organism: Klebsiella pneumoniae strain GYB02

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: QMW18_RS26655
• Protein ID: WP_001372321.1
• Coordinates: 92614..92739 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	92506..92537 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
QMW18_RS26605 (87727)	87727..87939	+	213	WP_001348622.1	hypothetical protein	-
QMW18_RS26610 (87852)	87852..88109	+	258	WP_023147917.1	hypothetical protein	-
QMW18_RS26615 (88349)	88349..88555	+	207	WP_000275856.1	hypothetical protein	-
QMW18_RS26620 (88581)	88581..89120	+	540	WP_000290840.1	single-stranded DNA-binding protein	-
QMW18_RS26625 (89188)	89188..89421	+	234	WP_000005990.1	DUF905 family protein	-
QMW18_RS26630 (89449)	89449..89646	+	198	Protein_106	hypothetical protein	-
QMW18_RS26635 (89701)	89701..90135	+	435	WP_000845937.1	conjugation system SOS inhibitor PsiB	-
QMW18_RS26640 (90132)	90132..90894	+	763	Protein_108	plasmid SOS inhibition protein A	-
- (90863)	90863..91060	+	198	NuclAT_1	-	-
- (90863)	90863..91060	+	198	NuclAT_1	-	-
- (90863)	90863..91060	+	198	NuclAT_1	-	-
- (90863)	90863..91060	+	198	NuclAT_1	-	-
QMW18_RS26645 (91108)	91108..92481	+	1374	Protein_109	IS3-like element IS150 family transposase	-
- (92506)	92506..92537	+	32	NuclAT_2	-	Antitoxin
- (92506)	92506..92537	+	32	NuclAT_2	-	Antitoxin
- (92506)	92506..92537	+	32	NuclAT_2	-	Antitoxin
- (92506)	92506..92537	+	32	NuclAT_2	-	Antitoxin
QMW18_RS26650 (92523)	92523..92672	+	150	Protein_110	plasmid maintenance protein Mok	-
QMW18_RS26655 (92614)	92614..92739	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
QMW18_RS26660 (92959)	92959..93189	+	231	WP_071886920.1	hypothetical protein	-
QMW18_RS26665 (93187)	93187..93359	-	173	Protein_113	hypothetical protein	-
QMW18_RS26670 (93429)	93429..93635	+	207	WP_000547968.1	hypothetical protein	-
QMW18_RS26675 (93660)	93660..93947	+	288	WP_000107535.1	hypothetical protein	-
QMW18_RS26680 (94065)	94065..94886	+	822	WP_001234426.1	DUF932 domain-containing protein	-
QMW18_RS26685 (95183)	95183..95773	-	591	WP_192849409.1	transglycosylase SLT domain-containing protein	-
QMW18_RS26690 (96106)	96106..96489	+	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-
QMW18_RS26695 (96676)	96676..97365	+	690	WP_000283385.1	conjugal transfer transcriptional regulator TraJ	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	aadA5 / qacE / sul1 / blaNDM-5 / tet(B) / qepA1 / rmtB / blaTEM-1B / blaCTX-M-55	iucA / iucB / iucC / iucD / iutA	1..211607	211607

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T282334 WP_001372321.1 NZ_CP125736:92614-92739 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 32 bp

>AT282334 NZ_CP125736:92506-92537 [Klebsiella pneumoniae]
CACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin