Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 715282..716057 | Replicon | chromosome |
Accession | NZ_CP125734 | ||
Organism | Klebsiella pneumoniae strain GYB02 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | B6ZBI6 |
Locus tag | QMW18_RS03540 | Protein ID | WP_004889762.1 |
Coordinates | 715572..716057 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | W8UEW1 |
Locus tag | QMW18_RS03535 | Protein ID | WP_004150912.1 |
Coordinates | 715282..715575 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QMW18_RS03515 (QMW18_03515) | 710491..711093 | - | 603 | WP_004174410.1 | short chain dehydrogenase | - |
QMW18_RS03520 (QMW18_03520) | 711191..712102 | + | 912 | WP_017879796.1 | LysR family transcriptional regulator | - |
QMW18_RS03525 (QMW18_03525) | 712103..713251 | - | 1149 | WP_004889759.1 | PLP-dependent aspartate aminotransferase family protein | - |
QMW18_RS03530 (QMW18_03530) | 713262..714638 | - | 1377 | WP_017879795.1 | pyridoxal-phosphate dependent enzyme | - |
QMW18_RS03535 (QMW18_03535) | 715282..715575 | + | 294 | WP_004150912.1 | DUF1778 domain-containing protein | Antitoxin |
QMW18_RS03540 (QMW18_03540) | 715572..716057 | + | 486 | WP_004889762.1 | GNAT family N-acetyltransferase | Toxin |
QMW18_RS03545 (QMW18_03545) | 716761..717353 | + | 593 | Protein_697 | hypothetical protein | - |
QMW18_RS03550 (QMW18_03550) | 717450..717666 | + | 217 | Protein_698 | transposase | - |
QMW18_RS03560 (QMW18_03560) | 718181..718894 | - | 714 | WP_002916694.1 | DUF554 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 717450..717602 | 152 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17585.56 Da Isoelectric Point: 8.5144
>T282318 WP_004889762.1 NZ_CP125734:715572-716057 [Klebsiella pneumoniae]
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPDPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDSMMLMVTLRDLVN
A
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPDPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDSMMLMVTLRDLVN
A
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A447W563 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GVL4 |