Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 358000..358646 | Replicon | chromosome |
Accession | NZ_CP125734 | ||
Organism | Klebsiella pneumoniae strain GYB02 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A483PC41 |
Locus tag | QMW18_RS01655 | Protein ID | WP_004216295.1 |
Coordinates | 358000..358347 (+) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | W8UB68 |
Locus tag | QMW18_RS01660 | Protein ID | WP_002920557.1 |
Coordinates | 358347..358646 (+) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QMW18_RS01645 (QMW18_01645) | 353926..355359 | + | 1434 | WP_004889438.1 | glycogen synthase GlgA | - |
QMW18_RS01650 (QMW18_01650) | 355377..357824 | + | 2448 | WP_002920561.1 | glycogen phosphorylase | - |
QMW18_RS01655 (QMW18_01655) | 358000..358347 | + | 348 | WP_004216295.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QMW18_RS01660 (QMW18_01660) | 358347..358646 | + | 300 | WP_002920557.1 | helix-turn-helix transcriptional regulator | Antitoxin |
QMW18_RS01665 (QMW18_01665) | 358709..360217 | - | 1509 | WP_002920554.1 | glycerol-3-phosphate dehydrogenase | - |
QMW18_RS01670 (QMW18_01670) | 360422..360751 | + | 330 | WP_002920552.1 | thiosulfate sulfurtransferase GlpE | - |
QMW18_RS01675 (QMW18_01675) | 360802..361632 | + | 831 | WP_004151408.1 | rhomboid family intramembrane serine protease GlpG | - |
QMW18_RS01680 (QMW18_01680) | 361682..362440 | + | 759 | WP_002920548.1 | DeoR/GlpR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13606.61 Da Isoelectric Point: 5.6749
>T282317 WP_004216295.1 NZ_CP125734:358000-358347 [Klebsiella pneumoniae]
MWDVETTDTFDTWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCADNKDGMNEKRFYKEMITLADREFSQHLTKER
MWDVETTDTFDTWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCADNKDGMNEKRFYKEMITLADREFSQHLTKER
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A483PC41 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E1CBF8 |