Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 3764292..3764986 | Replicon | chromosome |
Accession | NZ_CP125731 | ||
Organism | Escherichia coli strain GYB01 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | Q47157 |
Locus tag | QMW19_RS18295 | Protein ID | WP_001263489.1 |
Coordinates | 3764292..3764690 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1QAE3 |
Locus tag | QMW19_RS18300 | Protein ID | WP_000554758.1 |
Coordinates | 3764693..3764986 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
- (3759880) | 3759880..3759960 | - | 81 | NuclAT_11 | - | - |
- (3759880) | 3759880..3759960 | - | 81 | NuclAT_11 | - | - |
- (3759880) | 3759880..3759960 | - | 81 | NuclAT_11 | - | - |
- (3759880) | 3759880..3759960 | - | 81 | NuclAT_11 | - | - |
QMW19_RS18270 (3760556) | 3760556..3761014 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
QMW19_RS18275 (3761275) | 3761275..3762732 | + | 1458 | WP_001292994.1 | cytosol nonspecific dipeptidase | - |
QMW19_RS18280 (3762789) | 3762789..3763310 | - | 522 | Protein_3575 | peptide chain release factor H | - |
QMW19_RS18285 (3763306) | 3763306..3763512 | - | 207 | Protein_3576 | RtcB family protein | - |
QMW19_RS18290 (3763830) | 3763830..3764282 | - | 453 | WP_001059892.1 | GNAT family N-acetyltransferase | - |
QMW19_RS18295 (3764292) | 3764292..3764690 | - | 399 | WP_001263489.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
QMW19_RS18300 (3764693) | 3764693..3764986 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
QMW19_RS18305 (3765038) | 3765038..3766093 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
QMW19_RS18310 (3766164) | 3766164..3766949 | - | 786 | WP_000207552.1 | putative lateral flagellar export/assembly protein LafU | - |
QMW19_RS18315 (3766921) | 3766921..3768633 | + | 1713 | Protein_3582 | flagellar biosynthesis protein FlhA | - |
QMW19_RS18320 (3768857) | 3768857..3769354 | - | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | gmhA/lpcA | 3764292..3779572 | 15280 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15487.84 Da Isoelectric Point: 7.4215
>T282298 WP_001263489.1 NZ_CP125731:c3764690-3764292 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A090J8B1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1QAE3 |