Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) SprA2-sprA1AS/-
Location 25740..25897 Replicon plasmid unnamed3
Accession NZ_CP125721
Organism Staphylococcus casei strain DSM 15096

Toxin (Protein)


Gene name SprA2 Uniprot ID -
Locus tag QMO72_RS13895 Protein ID WP_107384574.1
Coordinates 25740..25835 (+) Length 32 a.a.

Antitoxin (RNA)


Gene name sprA1AS
Locus tag -
Coordinates 25861..25897 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QMO72_RS13880 (QMO72_13880) 22567..22986 + 420 WP_069821421.1 hypothetical protein -
QMO72_RS13885 (QMO72_13885) 25014..25280 - 267 WP_103267660.1 Txe/YoeB family addiction module toxin -
QMO72_RS13890 (QMO72_13890) 25281..25538 - 258 WP_069855823.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
QMO72_RS13895 (QMO72_13895) 25740..25835 + 96 WP_107384574.1 type I toxin-antitoxin system Fst family toxin Toxin
- 25861..25897 - 37 - - Antitoxin
QMO72_RS13900 (QMO72_13900) 26168..26413 - 246 WP_069855825.1 DUF3107 family protein -
QMO72_RS13905 (QMO72_13905) 26495..27040 - 546 WP_103267661.1 recombinase family protein -
QMO72_RS13910 (QMO72_13910) 27294..28109 - 816 WP_000164962.1 AAA family ATPase -
QMO72_RS13915 (QMO72_13915) 28102..29544 - 1443 WP_103267851.1 DDE-type integrase/transposase/recombinase -
QMO72_RS13920 (QMO72_13920) 29516..30109 - 594 WP_103267852.1 recombinase family protein -
QMO72_RS13925 (QMO72_13925) 30365..30805 - 441 WP_103267853.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..31460 31460


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.



Sequences

Toxin        


Download         Length: 32 a.a.        Molecular weight: 3624.32 Da        Isoelectric Point: 7.1630

>T282282 WP_107384574.1 NZ_CP125721:25740-25835 [Staphylococcus casei]
MLEILVHITTTVISGCIIALFTHWLRNREDK

Download         Length: 96 bp

Antitoxin


Download         Length: 37 bp

>AT282282 NZ_CP125721:c25897-25861 [Staphylococcus casei]
ATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References