Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
| Location | 3059812..3060358 | Replicon | chromosome |
| Accession | NZ_CP125669 | ||
| Organism | Acinetobacter sp. KCTC 92772 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | QLH32_RS14565 | Protein ID | WP_283266785.1 |
| Coordinates | 3060083..3060358 (-) | Length | 92 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QLH32_RS14560 | Protein ID | WP_283266783.1 |
| Coordinates | 3059812..3060090 (-) | Length | 93 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QLH32_RS14545 (QLH32_14545) | 3056524..3057147 | + | 624 | WP_283266779.1 | nuclease-related domain-containing protein | - |
| QLH32_RS14550 (QLH32_14550) | 3057314..3058918 | + | 1605 | WP_283266781.1 | choline dehydrogenase | - |
| QLH32_RS14555 (QLH32_14555) | 3059004..3059753 | - | 750 | WP_283266782.1 | NUDIX domain-containing protein | - |
| QLH32_RS14560 (QLH32_14560) | 3059812..3060090 | - | 279 | WP_283266783.1 | NadS family protein | Antitoxin |
| QLH32_RS14565 (QLH32_14565) | 3060083..3060358 | - | 276 | WP_283266785.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QLH32_RS14570 (QLH32_14570) | 3060560..3062047 | - | 1488 | WP_283266786.1 | nicotinate phosphoribosyltransferase | - |
| QLH32_RS14575 (QLH32_14575) | 3062072..3062950 | - | 879 | WP_283266787.1 | ribose-phosphate diphosphokinase | - |
| QLH32_RS14580 (QLH32_14580) | 3063320..3064495 | + | 1176 | WP_279959541.1 | zinc-binding dehydrogenase | - |
| QLH32_RS14585 (QLH32_14585) | 3064600..3065061 | - | 462 | WP_283266789.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10488.96 Da Isoelectric Point: 5.1409
>T282273 WP_283266785.1 NZ_CP125669:c3060358-3060083 [Acinetobacter sp. KCTC 92772]
MIDDDSYAKLQQALNEDPELGDLIRASGGIRKVRWNLEHTGKSGGIRVIYYYFDNEGQIFMLLAYPKSVKDNLTDRELTV
LRKLVEELKNV
MIDDDSYAKLQQALNEDPELGDLIRASGGIRKVRWNLEHTGKSGGIRVIYYYFDNEGQIFMLLAYPKSVKDNLTDRELTV
LRKLVEELKNV
Download Length: 276 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|