Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 1410657..1411195 | Replicon | chromosome |
Accession | NZ_CP125640 | ||
Organism | Rhizobium sp. BT03 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | - |
Locus tag | QMO80_RS07035 | Protein ID | WP_283200130.1 |
Coordinates | 1410657..1410785 (+) | Length | 43 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | - |
Locus tag | QMO80_RS07040 | Protein ID | WP_283199431.1 |
Coordinates | 1410827..1411195 (+) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QMO80_RS07020 (QMO80_001404) | 1406409..1408706 | - | 2298 | WP_283199428.1 | EAL domain-containing protein | - |
QMO80_RS07025 (QMO80_001405) | 1408953..1410323 | + | 1371 | WP_283199429.1 | TIGR03808 family TAT-translocated repetitive protein | - |
QMO80_RS07030 (QMO80_001406) | 1410484..1410657 | + | 174 | WP_283199430.1 | type II toxin-antitoxin system MqsR family toxin | - |
QMO80_RS07035 (QMO80_001407) | 1410657..1410785 | + | 129 | WP_283200130.1 | type II toxin-antitoxin system MqsR family toxin | Toxin |
QMO80_RS07040 (QMO80_001408) | 1410827..1411195 | + | 369 | WP_283199431.1 | type II toxin-antitoxin system MqsA family antitoxin | Antitoxin |
QMO80_RS07045 (QMO80_001409) | 1411339..1412004 | + | 666 | WP_283199432.1 | glutathione S-transferase family protein | - |
QMO80_RS07050 (QMO80_001410) | 1412249..1412695 | + | 447 | WP_283199433.1 | hypothetical protein | - |
QMO80_RS07055 (QMO80_001411) | 1412729..1413625 | - | 897 | WP_283199434.1 | LysR substrate-binding domain-containing protein | - |
QMO80_RS07060 (QMO80_001412) | 1413804..1414001 | + | 198 | WP_283199435.1 | hypothetical protein | - |
QMO80_RS07065 (QMO80_001413) | 1414176..1415060 | + | 885 | WP_283199436.1 | GntR family transcriptional regulator | - |
QMO80_RS07070 (QMO80_001414) | 1415061..1416119 | - | 1059 | WP_283199437.1 | lactonase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 43 a.a. Molecular weight: 4746.28 Da Isoelectric Point: 4.3220
>T282226 WP_283200130.1 NZ_CP125640:1410657-1410785 [Rhizobium sp. BT03]
MTTYSDNTIWQDVYHADTPAGKAYVKVTLREDGAPVIQFTEL
MTTYSDNTIWQDVYHADTPAGKAYVKVTLREDGAPVIQFTEL
Download Length: 129 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13802.51 Da Isoelectric Point: 7.9090
>AT282226 WP_283199431.1 NZ_CP125640:1410827-1411195 [Rhizobium sp. BT03]
MTPFFNETHHVTFRNLKADVEGLSGFRCGACGEIEYDQISAERYARASDALILQDRRAVGEDLRRIRKKLRLNQTEASAL
TGGGHNAFSRYETGKVSPSPAVVNLFRLLERHPDDIEELRRA
MTPFFNETHHVTFRNLKADVEGLSGFRCGACGEIEYDQISAERYARASDALILQDRRAVGEDLRRIRKKLRLNQTEASAL
TGGGHNAFSRYETGKVSPSPAVVNLFRLLERHPDDIEELRRA
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|