Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 3534688..3535358 | Replicon | chromosome |
| Accession | NZ_CP125620 | ||
| Organism | Mycobacterium tuberculosis strain BLR 4299 2019 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | O53332 |
| Locus tag | O3Q54_RS16765 | Protein ID | WP_003899954.1 |
| Coordinates | 3534688..3535032 (+) | Length | 115 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | G0THF6 |
| Locus tag | O3Q54_RS16770 | Protein ID | WP_003899955.1 |
| Coordinates | 3535029..3535358 (+) | Length | 110 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O3Q54_RS16730 (O3Q54_16730) | 3529761..3530621 | + | 861 | WP_003416628.1 | alpha/beta hydrolase | - |
| O3Q54_RS16735 (O3Q54_16735) | 3530596..3531111 | + | 516 | WP_003899950.1 | nitroreductase family deazaflavin-dependent oxidoreductase | - |
| O3Q54_RS16740 (O3Q54_16740) | 3531127..3531338 | + | 212 | Protein_3305 | (R)-hydratase | - |
| O3Q54_RS16745 (O3Q54_16745) | 3531351..3531644 | + | 294 | WP_003416635.1 | hypothetical protein | - |
| O3Q54_RS16750 (O3Q54_16750) | 3531932..3533221 | + | 1290 | WP_003906996.1 | ATP-binding protein | - |
| O3Q54_RS16755 (O3Q54_16755) | 3533568..3534002 | - | 435 | WP_003899952.1 | type II toxin-antitoxin system VapC family toxin | - |
| O3Q54_RS16760 (O3Q54_16760) | 3534005..3534457 | - | 453 | WP_003899953.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| O3Q54_RS16765 (O3Q54_16765) | 3534688..3535032 | + | 345 | WP_003899954.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| O3Q54_RS16770 (O3Q54_16770) | 3535029..3535358 | + | 330 | WP_003899955.1 | XRE family transcriptional regulator | Antitoxin |
| O3Q54_RS16775 (O3Q54_16775) | 3535896..3536243 | + | 348 | WP_003899956.1 | DUF2384 domain-containing protein | - |
| O3Q54_RS16780 (O3Q54_16780) | 3536240..3536860 | + | 621 | WP_003899957.1 | RES family NAD+ phosphorylase | - |
| O3Q54_RS16785 (O3Q54_16785) | 3537020..3538285 | - | 1266 | WP_003902423.1 | hypothetical protein | - |
| O3Q54_RS16790 (O3Q54_16790) | 3538453..3538662 | + | 210 | WP_003416778.1 | hypothetical protein | - |
| O3Q54_RS16795 (O3Q54_16795) | 3538909..3539943 | - | 1035 | WP_003416786.1 | IS30 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 12692.50 Da Isoelectric Point: 5.6920
>T282217 WP_003899954.1 NZ_CP125620:3534688-3535032 [Mycobacterium tuberculosis]
MAVILLPQVERWFFALNRDAMASVTGAIDLLEMEGPTLGRPVVDKVNDSTFHNMKELRPAGTSIRILFAFDPARQAILLL
GGDKAGNWKRWYDNNIPIADQRSENWLASEHGGG
MAVILLPQVERWFFALNRDAMASVTGAIDLLEMEGPTLGRPVVDKVNDSTFHNMKELRPAGTSIRILFAFDPARQAILLL
GGDKAGNWKRWYDNNIPIADQRSENWLASEHGGG
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4FBK2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6LTY | |
| PDB | 6LTZ | |
| AlphaFold DB | G0THF6 |