Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 2247938..2248857 | Replicon | chromosome |
| Accession | NZ_CP125620 | ||
| Organism | Mycobacterium tuberculosis strain BLR 4299 2019 | ||
Toxin (Protein)
| Gene name | HigB2 | Uniprot ID | A0A654U351 |
| Locus tag | O3Q54_RS10565 | Protein ID | WP_003906719.1 |
| Coordinates | 2248252..2248857 (-) | Length | 202 a.a. |
Antitoxin (Protein)
| Gene name | HigA2 | Uniprot ID | L7N5K9 |
| Locus tag | O3Q54_RS10560 | Protein ID | WP_003410124.1 |
| Coordinates | 2247938..2248243 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O3Q54_RS10530 (O3Q54_10530) | 2242949..2244205 | - | 1257 | WP_003410095.1 | HNH endonuclease signature motif containing protein | - |
| O3Q54_RS10535 (O3Q54_10535) | 2244559..2245134 | + | 576 | WP_003410100.1 | hypothetical protein | - |
| O3Q54_RS10540 (O3Q54_10540) | 2245131..2246171 | + | 1041 | WP_003410103.1 | ImmA/IrrE family metallo-endopeptidase | - |
| O3Q54_RS10545 (O3Q54_10545) | 2246413..2247132 | + | 720 | WP_003410108.1 | DUF433 domain-containing protein | - |
| O3Q54_RS10550 (O3Q54_10550) | 2247122..2247538 | + | 417 | WP_003410114.1 | hypothetical protein | - |
| O3Q54_RS10555 (O3Q54_10555) | 2247554..2247853 | - | 300 | WP_003410120.1 | hypothetical protein | - |
| O3Q54_RS10560 (O3Q54_10560) | 2247938..2248243 | - | 306 | WP_003410124.1 | XRE family transcriptional regulator | Antitoxin |
| O3Q54_RS10565 (O3Q54_10565) | 2248252..2248857 | - | 606 | WP_003906719.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| O3Q54_RS10570 (O3Q54_10570) | 2248882..2249241 | - | 360 | WP_003410131.1 | hypothetical protein | - |
| O3Q54_RS10575 (O3Q54_10575) | 2249401..2250033 | - | 633 | WP_003913310.1 | hypothetical protein | - |
| O3Q54_RS10580 (O3Q54_10580) | 2250030..2250266 | - | 237 | WP_003410133.1 | hypothetical protein | - |
| O3Q54_RS10585 (O3Q54_10585) | 2250473..2251369 | - | 897 | WP_003906720.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 202 a.a. Molecular weight: 22716.91 Da Isoelectric Point: 7.3073
>T282199 WP_003906719.1 NZ_CP125620:c2248857-2248252 [Mycobacterium tuberculosis]
VNVPWENAHGGALYCLIRGDEFSAWHRLLFQRPGCAESVLACRHFLDGSPVARCSYPEEYHPCVISRIALLCDSVGWTAD
VERISAWLNGLDRETYELVFAAIEVLEEEGPALGCPLADTVRGSRHKNMKELRPGSQGRSEVRILFAFDPARQAIMLAAG
NKAGRWTQWYDEKIKAADEMFAEHLAQFEDTKPKRRKRKKG
VNVPWENAHGGALYCLIRGDEFSAWHRLLFQRPGCAESVLACRHFLDGSPVARCSYPEEYHPCVISRIALLCDSVGWTAD
VERISAWLNGLDRETYELVFAAIEVLEEEGPALGCPLADTVRGSRHKNMKELRPGSQGRSEVRILFAFDPARQAIMLAAG
NKAGRWTQWYDEKIKAADEMFAEHLAQFEDTKPKRRKRKKG
Download Length: 606 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A654U351 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 7EWC | |
| PDB | 7EWD | |
| PDB | 7EWE | |
| AlphaFold DB | A0A7U4BV30 |