Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/Gp49-HTH_37 |
| Location | 2181492..2182360 | Replicon | chromosome |
| Accession | NZ_CP125620 | ||
| Organism | Mycobacterium tuberculosis strain BLR 4299 2019 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | P9WJA4 |
| Locus tag | O3Q54_RS10180 | Protein ID | WP_010886136.1 |
| Coordinates | 2181492..2181869 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | G0TLM0 |
| Locus tag | O3Q54_RS10185 | Protein ID | WP_003409886.1 |
| Coordinates | 2181911..2182360 (+) | Length | 150 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O3Q54_RS10130 (O3Q54_10130) | 2177281..2177733 | - | 453 | WP_003899095.1 | lipoprotein | - |
| O3Q54_RS10135 (O3Q54_10135) | 2177797..2178198 | + | 402 | WP_003409869.1 | hypothetical protein | - |
| O3Q54_RS10140 (O3Q54_10140) | 2178191..2178373 | - | 183 | WP_003409870.1 | hypothetical protein | - |
| O3Q54_RS10145 (O3Q54_10145) | 2178487..2178837 | - | 351 | WP_003899096.1 | hypothetical protein | - |
| O3Q54_RS10150 (O3Q54_10150) | 2178848..2179750 | - | 903 | WP_003899097.1 | hypothetical protein | - |
| O3Q54_RS10155 (O3Q54_10155) | 2179771..2179962 | - | 192 | WP_003409876.1 | hypothetical protein | - |
| O3Q54_RS10160 (O3Q54_10160) | 2179963..2180259 | - | 297 | WP_003409877.1 | hypothetical protein | - |
| O3Q54_RS10165 (O3Q54_10165) | 2180499..2180714 | + | 216 | WP_003409878.1 | antitoxin | - |
| O3Q54_RS10170 (O3Q54_10170) | 2180711..2181022 | + | 312 | WP_003409881.1 | type II toxin-antitoxin system VapC family toxin | - |
| O3Q54_RS10175 (O3Q54_10175) | 2180996..2181517 | - | 522 | WP_003904745.1 | hypothetical protein | - |
| O3Q54_RS10180 (O3Q54_10180) | 2181492..2181869 | + | 378 | WP_010886136.1 | type II toxin-antitoxin system toxin HigB | Toxin |
| O3Q54_RS10185 (O3Q54_10185) | 2181911..2182360 | + | 450 | WP_003409886.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
| O3Q54_RS10190 (O3Q54_10190) | 2182357..2182902 | + | 546 | WP_003409891.1 | SecB-like chaperone | - |
| O3Q54_RS10195 (O3Q54_10195) | 2182791..2183405 | - | 615 | WP_003901296.1 | hypothetical protein | - |
| O3Q54_RS10200 (O3Q54_10200) | 2183454..2183750 | - | 297 | WP_003409896.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| O3Q54_RS10205 (O3Q54_10205) | 2183747..2183998 | - | 252 | WP_003409899.1 | type II toxin-antitoxin system ParD family antitoxin | - |
| O3Q54_RS10210 (O3Q54_10210) | 2183985..2184479 | + | 495 | WP_003899099.1 | hypothetical protein | - |
| O3Q54_RS10215 (O3Q54_10215) | 2184639..2185046 | - | 408 | WP_003409913.1 | type II toxin-antitoxin system VapC family toxin | - |
| O3Q54_RS10220 (O3Q54_10220) | 2185050..2185322 | - | 273 | WP_003899100.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| O3Q54_RS10225 (O3Q54_10225) | 2185355..2186575 | - | 1221 | WP_003409919.1 | TetR family transcriptional regulator Mce3R | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14397.77 Da Isoelectric Point: 10.8862
>T282193 WP_010886136.1 NZ_CP125620:2181492-2181869 [Mycobacterium tuberculosis]
VPPPDPAAMGTWKFFRASVDGRPVFKKEFDKLPDQARAALIVLMQRYLVGDLAAGSIKPIRGDILELRWHEANNHFRVLF
FRWGQHPVALTAFYKNQQKTPKTKIETALDRQKIWKRAFGDTPPI
VPPPDPAAMGTWKFFRASVDGRPVFKKEFDKLPDQARAALIVLMQRYLVGDLAAGSIKPIRGDILELRWHEANNHFRVLF
FRWGQHPVALTAFYKNQQKTPKTKIETALDRQKIWKRAFGDTPPI
Download Length: 378 bp
Antitoxin
Download Length: 150 a.a. Molecular weight: 16760.16 Da Isoelectric Point: 8.0771
>AT282193 WP_003409886.1 NZ_CP125620:2181911-2182360 [Mycobacterium tuberculosis]
MSIDFPLGDDLAGYIAEAIAADPSFKGTLEDAEEARRLVDALIALRKHCQLSQVEVAKRMGVRQPTVSGFEKEPSDPKLS
TLQRYARALDARLRLVLEVPTLREVPTWHRLSSYRGSARDHQVRVGADKEILMQTNWARHISVRQVEVA
MSIDFPLGDDLAGYIAEAIAADPSFKGTLEDAEEARRLVDALIALRKHCQLSQVEVAKRMGVRQPTVSGFEKEPSDPKLS
TLQRYARALDARLRLVLEVPTLREVPTWHRLSSYRGSARDHQVRVGADKEILMQTNWARHISVRQVEVA
Download Length: 450 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|