Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 5961430..5962025 | Replicon | chromosome |
Accession | NZ_CP125365 | ||
Organism | Pseudomonas aeruginosa strain ZY36 |
Toxin (Protein)
Gene name | higB | Uniprot ID | V6ALY3 |
Locus tag | QMK42_RS27865 | Protein ID | WP_003113526.1 |
Coordinates | 5961747..5962025 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QMK42_RS27860 | Protein ID | WP_003099268.1 |
Coordinates | 5961430..5961735 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QMK42_RS27830 (QMK42_27830) | 5956476..5956910 | - | 435 | WP_009875803.1 | hypothetical protein | - |
QMK42_RS27835 (QMK42_27835) | 5957426..5957716 | - | 291 | WP_152959653.1 | DUF5447 family protein | - |
QMK42_RS27840 (QMK42_27840) | 5957892..5958164 | - | 273 | WP_058175553.1 | hypothetical protein | - |
QMK42_RS27845 (QMK42_27845) | 5958611..5958946 | + | 336 | WP_058175552.1 | hypothetical protein | - |
QMK42_RS27850 (QMK42_27850) | 5958949..5959650 | - | 702 | WP_152959654.1 | retron Ec48 family effector membrane protein | - |
QMK42_RS27855 (QMK42_27855) | 5959637..5960812 | - | 1176 | WP_071557852.1 | reverse transcriptase family protein | - |
QMK42_RS27860 (QMK42_27860) | 5961430..5961735 | - | 306 | WP_003099268.1 | HigA family addiction module antitoxin | Antitoxin |
QMK42_RS27865 (QMK42_27865) | 5961747..5962025 | - | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QMK42_RS27870 (QMK42_27870) | 5962078..5962206 | - | 129 | Protein_5511 | integrase | - |
QMK42_RS27875 (QMK42_27875) | 5962354..5964582 | + | 2229 | WP_003099265.1 | TonB-dependent receptor | - |
QMK42_RS27880 (QMK42_27880) | 5964652..5965299 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
QMK42_RS27885 (QMK42_27885) | 5965361..5966599 | - | 1239 | WP_003113524.1 | dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T282138 WP_003113526.1 NZ_CP125365:c5962025-5961747 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|