Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yefM-yoeB (relBE)/YoeB-RelB |
Location | 294697..295210 | Replicon | chromosome |
Accession | NZ_CP125359 | ||
Organism | Streptococcus dysgalactiae subsp. equisimilis strain UT_10236 |
Toxin (Protein)
Gene name | yoeB | Uniprot ID | - |
Locus tag | OPT60_RS01625 | Protein ID | WP_084916229.1 |
Coordinates | 294697..294951 (-) | Length | 85 a.a. |
Antitoxin (Protein)
Gene name | yefM | Uniprot ID | - |
Locus tag | OPT60_RS01630 | Protein ID | WP_003053797.1 |
Coordinates | 294944..295210 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OPT60_RS01595 (OPT60_01595) | 290939..291349 | - | 411 | WP_003053802.1 | conjugal transfer protein | - |
OPT60_RS01600 (OPT60_01600) | 291352..291576 | - | 225 | WP_003053785.1 | hypothetical protein | - |
OPT60_RS01605 (OPT60_01605) | 291580..292590 | - | 1011 | WP_022554213.1 | conjugal transfer protein | - |
OPT60_RS01610 (OPT60_01610) | 292602..293138 | - | 537 | WP_003053800.1 | hypothetical protein | - |
OPT60_RS01615 (OPT60_01615) | 293165..293395 | - | 231 | WP_003053793.1 | hypothetical protein | - |
OPT60_RS01620 (OPT60_01620) | 293415..294641 | - | 1227 | WP_084916231.1 | replication initiation factor domain-containing protein | - |
OPT60_RS01625 (OPT60_01625) | 294697..294951 | - | 255 | WP_084916229.1 | Txe/YoeB family addiction module toxin | Toxin |
OPT60_RS01630 (OPT60_01630) | 294944..295210 | - | 267 | WP_003053797.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
OPT60_RS01635 (OPT60_01635) | 295475..297160 | - | 1686 | WP_084916228.1 | FtsK/SpoIIIE domain-containing protein | - |
OPT60_RS01640 (OPT60_01640) | 297177..297638 | - | 462 | WP_003056467.1 | hypothetical protein | - |
OPT60_RS01645 (OPT60_01645) | 297657..297953 | - | 297 | WP_003056470.1 | hypothetical protein | - |
OPT60_RS01650 (OPT60_01650) | 297993..298238 | - | 246 | WP_003056472.1 | hypothetical protein | - |
OPT60_RS01655 (OPT60_01655) | 298811..299152 | + | 342 | WP_110408064.1 | helix-turn-helix transcriptional regulator | - |
OPT60_RS01660 (OPT60_01660) | 299356..299661 | + | 306 | WP_014612001.1 | hypothetical protein | - |
OPT60_RS01665 (OPT60_01665) | 299696..300055 | - | 360 | WP_003053656.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 269172..310934 | 41762 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 85 a.a. Molecular weight: 10502.78 Da Isoelectric Point: 8.4060
>T282113 WP_084916229.1 NZ_CP125359:c294951-294697 [Streptococcus dysgalactiae subsp. equisimilis]
MFNFTEEAWEDYTSWQREDKKNLKRINRLIEDIKRHPFEGIGKPEPLKYRYSGAWSRRITDEHRLVYTVEQNDIYFLSFR
DHYK
MFNFTEEAWEDYTSWQREDKKNLKRINRLIEDIKRHPFEGIGKPEPLKYRYSGAWSRRITDEHRLVYTVEQNDIYFLSFR
DHYK
Download Length: 255 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|